Recombinant Human CCRL2/CRAM-A/B Protein

Images

 
There are currently no images for CCRL2/CRAM-A/B Recombinant Protein (H00009034-G01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary

Order Details

Recombinant Human CCRL2/CRAM-A/B Protein Summary

Description
CCRL2/CRAM-A/B (Human) Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MANYTLAPEDEYDVLIEGELESDEAEQCDKYDAQALSAQLVPSLCSAVFVIGVLDNLLVVLILVKYKGLKRVENIYLLNLAVSNLCFLLTLPFWAHAGGDPMCKILIGLYFVGLYSETFFNCLLTVQRYLVFLHKGNFFSARRRVPCGIITSVLAWVTAILATLPEFVVYKPQMEDQKYKCAFSRTPFLPADETFWKHFLTLKMNISVLVLPLFIFTFLYVQMRKTLRFREQRYSLFKLVFAIMVVFLLMWAPYNIAFFLSTFKEHFSLSDCKSSYNLDKSVHITKLIATTHCCINPLLYAFLDGTFSKYLCRCFHLRSNTPLQPRGQSAQGTSREEPDHSTEV
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
CCRL2

Applications/Dilutions

Application Notes
This product is recommended to use in Functional study and Compund screening, not validated yet.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Preservative
No Preservative

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CCRL2/CRAM-A/B Protein

  • ACKR5
  • C-C chemokine receptor-like 2
  • CCR11
  • CCR6
  • CCRL2
  • CCRL2/CRAM-A/B
  • chemokine (C-C motif) receptor-like 2
  • Chemokine receptor CCR11
  • Chemokine receptor X
  • CKRX
  • CKRXMGC116710
  • CRAM
  • CRAMA
  • CRAM-A
  • CRAMB
  • CRAM-B
  • FLJ55815
  • HCR
  • HCRMGC34104
  • Putative MCP-1 chemokine receptor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB197
Species: Hu
Applications: Flow, CyTOF-reported, ICC, Neut
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB182
Species: Hu
Applications: Flow, CyTOF-ready, ICC, Neut
MAB160
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
H00025819-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
FAB1567P
Species: Hu, Rt
Applications: Flow
NBP1-86564
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB170R
Species: Hu
Applications: Flow, Neut
NBP2-37476
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB1364
Species: Hu
Applications: Flow, CyTOF-ready

Publications for CCRL2/CRAM-A/B Recombinant Protein (H00009034-G01) (0)

There are no publications for CCRL2/CRAM-A/B Recombinant Protein (H00009034-G01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCRL2/CRAM-A/B Recombinant Protein (H00009034-G01) (0)

There are no reviews for CCRL2/CRAM-A/B Recombinant Protein (H00009034-G01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

FAQs for CCRL2/CRAM-A/B Recombinant Protein (H00009034-G01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CCRL2/CRAM-A/B Products

Related Products by Gene

Bioinformatics Tool for CCRL2/CRAM-A/B Recombinant Protein (H00009034-G01)

Discover related pathways, diseases and genes to CCRL2/CRAM-A/B Recombinant Protein (H00009034-G01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCRL2/CRAM-A/B Recombinant Protein (H00009034-G01)

Discover more about diseases related to CCRL2/CRAM-A/B Recombinant Protein (H00009034-G01).
 

Pathways for CCRL2/CRAM-A/B Recombinant Protein (H00009034-G01)

View related products by pathway.

PTMs for CCRL2/CRAM-A/B Recombinant Protein (H00009034-G01)

Learn more about PTMs related to CCRL2/CRAM-A/B Recombinant Protein (H00009034-G01).
 

Research Areas for CCRL2/CRAM-A/B Recombinant Protein (H00009034-G01)

Find related products by research area.

Blogs on CCRL2/CRAM-A/B

There are no specific blogs for CCRL2/CRAM-A/B, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our Recombinant Human CCRL2/CRAM-A/B Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CCRL2
Entrez

Customers Who Bought This Also Bought