CCRL2/CRAM-A/B Recombinant Protein

Images

 
There are currently no images for CCRL2/CRAM-A/B Recombinant Protein (H00009034-G01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary

Order Details

CCRL2/CRAM-A/B Recombinant Protein Summary

Description
CCRL2/CRAM-A/B (Human) Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MANYTLAPEDEYDVLIEGELESDEAEQCDKYDAQALSAQLVPSLCSAVFVIGVLDNLLVVLILVKYKGLKRVENIYLLNLAVSNLCFLLTLPFWAHAGGDPMCKILIGLYFVGLYSETFFNCLLTVQRYLVFLHKGNFFSARRRVPCGIITSVLAWVTAILATLPEFVVYKPQMEDQKYKCAFSRTPFLPADETFWKHFLTLKMNISVLVLPLFIFTFLYVQMRKTLRFREQRYSLFKLVFAIMVVFLLMWAPYNIAFFLSTFKEHFSLSDCKSSYNLDKSVHITKLIATTHCCINPLLYAFLDGTFSKYLCRCFHLRSNTPLQPRGQSAQGTSREEPDHSTEV
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Gene
CCRL2

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Preservative
No Preservative

Applications/Dilutions

Application Notes
This product is recommended to use in Functional study and Compund screening, not validated yet.

Reactivity Notes

Human

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CCRL2/CRAM-A/B Recombinant Protein

  • ACKR5
  • C-C chemokine receptor-like 2
  • CCR11
  • CCR6
  • CCRL2
  • CCRL2/CRAM-A/B
  • chemokine (C-C motif) receptor-like 2
  • Chemokine receptor CCR11
  • Chemokine receptor X
  • CKRX
  • CKRXMGC116710
  • CRAM
  • CRAMA
  • CRAM-A
  • CRAMB
  • CRAM-B
  • FLJ55815
  • HCR
  • HCRMGC34104
  • Putative MCP-1 chemokine receptor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB197
Species: Hu
Applications: Flow, ICC, Neut
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB182
Species: Hu
Applications: Flow, ICC, Neut
MAB160
Species: Hu
Applications: Flow, IHC, Neut
H00025819-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
MAB1567
Species: Hu
Applications: Flow
NBP1-86564
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB170R
Species: Hu
Applications: Flow, Neut
NBP2-37476
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC
FAB5538P
Species: Mu
Applications: Flow
MAB1364
Species: Hu
Applications: Flow
H00009034-G01
Species: Hu

Publications for CCRL2/CRAM-A/B Recombinant Protein (H00009034-G01) (0)

There are no publications for CCRL2/CRAM-A/B Recombinant Protein (H00009034-G01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCRL2/CRAM-A/B Recombinant Protein (H00009034-G01) (0)

There are no reviews for CCRL2/CRAM-A/B Recombinant Protein (H00009034-G01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

FAQs for CCRL2/CRAM-A/B Recombinant Protein (H00009034-G01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CCRL2/CRAM-A/B Recombinant Protein Products

Related Products by Gene

Bioinformatics Tool for CCRL2/CRAM-A/B Recombinant Protein (H00009034-G01)

Discover related pathways, diseases and genes to CCRL2/CRAM-A/B Recombinant Protein (H00009034-G01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCRL2/CRAM-A/B Recombinant Protein (H00009034-G01)

Discover more about diseases related to CCRL2/CRAM-A/B Recombinant Protein (H00009034-G01).
 

Pathways for CCRL2/CRAM-A/B Recombinant Protein (H00009034-G01)

View related products by pathway.

PTMs for CCRL2/CRAM-A/B Recombinant Protein (H00009034-G01)

Learn more about PTMs related to CCRL2/CRAM-A/B Recombinant Protein (H00009034-G01).
 

Research Areas for CCRL2/CRAM-A/B Recombinant Protein (H00009034-G01)

Find related products by research area.

Blogs on CCRL2/CRAM-A/B

There are no specific blogs for CCRL2/CRAM-A/B, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol CCRL2
Entrez

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on H00009034-G01 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought