Recombinant Human CCRL2/CRAM-A/B Protein

Images

 
There are currently no images for CCRL2/CRAM-A/B Recombinant Protein (H00009034-G01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications Func

Order Details

Recombinant Human CCRL2/CRAM-A/B Protein Summary

Description
CCRL2/CRAM-A/B (Human) Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MANYTLAPEDEYDVLIEGELESDEAEQCDKYDAQALSAQLVPSLCSAVFVIGVLDNLLVVLILVKYKGLKRVENIYLLNLAVSNLCFLLTLPFWAHAGGDPMCKILIGLYFVGLYSETFFNCLLTVQRYLVFLHKGNFFSARRRVPCGIITSVLAWVTAILATLPEFVVYKPQMEDQKYKCAFSRTPFLPADETFWKHFLTLKMNISVLVLPLFIFTFLYVQMRKTLRFREQRYSLFKLVFAIMVVFLLMWAPYNIAFFLSTFKEHFSLSDCKSSYNLDKSVHITKLIATTHCCINPLLYAFLDGTFSKYLCRCFHLRSNTPLQPRGQSAQGTSREEPDHSTEV
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
CCRL2

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Preservative
No Preservative

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CCRL2/CRAM-A/B Protein

  • ACKR5
  • C-C chemokine receptor-like 2
  • CCR11
  • CCR6
  • CCRL2
  • CCRL2/CRAM-A/B
  • chemokine (C-C motif) receptor-like 2
  • Chemokine receptor CCR11
  • Chemokine receptor X
  • CKRX
  • CKRXMGC116710
  • CRAM
  • CRAMA
  • CRAM-A
  • CRAMB
  • CRAM-B
  • FLJ55815
  • HCR
  • HCRMGC34104
  • Putative MCP-1 chemokine receptor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB197
Species: Hu
Applications: Flow, CyTOF-reported, ICC, Neut
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB182
Species: Hu
Applications: Flow, CyTOF-ready, ICC, Neut
MAB160
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
NBP2-37856
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB1567
Species: Hu
Applications: Flow, CyTOF-reported
NBP1-86564
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB172
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP1-48337
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
366-6C/CF
Species: Hu
MAB1364
Species: Hu
Applications: Flow, CyTOF-ready

Publications for CCRL2/CRAM-A/B Recombinant Protein (H00009034-G01) (0)

There are no publications for CCRL2/CRAM-A/B Recombinant Protein (H00009034-G01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCRL2/CRAM-A/B Recombinant Protein (H00009034-G01) (0)

There are no reviews for CCRL2/CRAM-A/B Recombinant Protein (H00009034-G01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for CCRL2/CRAM-A/B Recombinant Protein (H00009034-G01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CCRL2/CRAM-A/B Products

Bioinformatics Tool for CCRL2/CRAM-A/B Recombinant Protein (H00009034-G01)

Discover related pathways, diseases and genes to CCRL2/CRAM-A/B Recombinant Protein (H00009034-G01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCRL2/CRAM-A/B Recombinant Protein (H00009034-G01)

Discover more about diseases related to CCRL2/CRAM-A/B Recombinant Protein (H00009034-G01).
 

Pathways for CCRL2/CRAM-A/B Recombinant Protein (H00009034-G01)

View related products by pathway.

PTMs for CCRL2/CRAM-A/B Recombinant Protein (H00009034-G01)

Learn more about PTMs related to CCRL2/CRAM-A/B Recombinant Protein (H00009034-G01).
 

Research Areas for CCRL2/CRAM-A/B Recombinant Protein (H00009034-G01)

Find related products by research area.

Blogs on CCRL2/CRAM-A/B

There are no specific blogs for CCRL2/CRAM-A/B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-4 [Unconjugated]
204-IL-010/CF
IL-4 [Unconjugated]
204-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CCRL2/CRAM-A/B Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CCRL2
Entrez