CCL15/MIP-1 delta Antibody Summary
| Description |
Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen |
CCL15 (NP_004158.2, 1 a.a. - 113 a.a.) full-length human protein. MKVSVAALSCLMLVAVLGSQAQFINDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CCL15 |
| Purity |
Protein G purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
It has been used for WB and Functional. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Protein G purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for CCL15/MIP-1 delta Antibody
Background
CCL15 - chemokine (C-C motif) ligand 15
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA, BA
Species: Hu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
Species: Hu
Applications: BA
Species: Mu
Applications: Neut, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow, IHC
Species: Hu
Applications: ELISA, IHC, IHC-P, KD, S-ELISA, WB
Species: Mu
Applications: IHC, Neut, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Neut
Publications for CCL15/MIP-1 delta Antibody (H00006359-D01P) (0)
There are no publications for CCL15/MIP-1 delta Antibody (H00006359-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CCL15/MIP-1 delta Antibody (H00006359-D01P) (0)
There are no reviews for CCL15/MIP-1 delta Antibody (H00006359-D01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CCL15/MIP-1 delta Antibody (H00006359-D01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CCL15/MIP-1 delta Products
Research Areas for CCL15/MIP-1 delta Antibody (H00006359-D01P)
Find related products by research area.
|
Blogs on CCL15/MIP-1 delta