CCDC63 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CCDC63 Antibody [NBP2-14453] - Staining of human cell line U-2 OS shows positivity in plasma membrane and cytoplasm.
Immunohistochemistry-Paraffin: CCDC63 Antibody [NBP2-14453] - Staining of human stomach, lower shows strong nuclear membrane positivity in glandular cells.

Product Details

Summary
Product Discontinued
View other related CCDC63 Primary Antibodies

Order Details


    • Catalog Number
      NBP2-14453
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

CCDC63 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YGEVSKTLDLLKNSVEKLFKKINCDATKILVQLGETGKVTDINLPQYFAI IEKKTNDLLLLETYRRILEVEGAEAEIPPPFINPFWGGSALLKPPEPIKV I
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCDC63
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CCDC63 Antibody

  • coiled-coil domain containing 63
  • FLJ35843

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37397
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP1-91815
Species: Hu
Applications: IHC, IHC-P
NBP1-30249
Species: Hu, Mu, Rt, Xp
Applications: WB, ELISA, Flow, ICC/IF
NBP1-69184
Species: Mu, Rt
Applications: WB
NBP2-30719
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CCDC63 Antibody (NBP2-14453) (0)

There are no publications for CCDC63 Antibody (NBP2-14453).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCDC63 Antibody (NBP2-14453) (0)

There are no reviews for CCDC63 Antibody (NBP2-14453). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CCDC63 Antibody (NBP2-14453) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CCDC63 Products

CCDC63 NBP2-14453

Bioinformatics Tool for CCDC63 Antibody (NBP2-14453)

Discover related pathways, diseases and genes to CCDC63 Antibody (NBP2-14453). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCDC63 Antibody (NBP2-14453)

Discover more about diseases related to CCDC63 Antibody (NBP2-14453).

Blogs on CCDC63

There are no specific blogs for CCDC63, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCDC63 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCDC63