CCDC38 Antibody

Images

 
Western Blot: CCDC38 Antibody [NBP1-83460] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted)
Immunohistochemistry-Paraffin: CCDC38 Antibody [NBP1-83460] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Product Details

Summary
Product Discontinued
View other related CCDC38 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-83460
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

CCDC38 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EILIDSLSKKITQVYKVCIGDAEDDGLNPIQKLVKVESRLVELCDLIESIPKENVEAIERMKQKEWRQKFRDEKMKEKQRHQQERLKAALE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCDC38
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CCDC38 Antibody

  • coiled-coil domain containing 38
  • coiled-coil domain-containing protein 38
  • FLJ40089

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

28100002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-52506
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
NBP2-14802
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88680
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88730
Species: Hu
Applications: IHC, IHC-P
NBP1-81776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4977
Species: Mu
Applications: WB
NBP2-45600
Species: Hu, Ca, Mk
Applications: WB, IHC, IF
NBP1-31566
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB9161
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
302-B2/CF
Species: Hu
1849-NK
Species: Hu
MAB197
Species: Hu
Applications: Flow, CyTOF-reported, ICC, Neut
NB100-56341
Species: Hu
Applications: WB, ChIP, IP
NBP1-83493
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38146
Species: Hu
Applications: IHC, IHC-P
H00010438-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-83460
Species: Hu
Applications: WB, IHC, IHC-P

Publications for CCDC38 Antibody (NBP1-83460) (0)

There are no publications for CCDC38 Antibody (NBP1-83460).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCDC38 Antibody (NBP1-83460) (0)

There are no reviews for CCDC38 Antibody (NBP1-83460). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CCDC38 Antibody (NBP1-83460) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CCDC38 Products

CCDC38 NBP1-83460

Bioinformatics Tool for CCDC38 Antibody (NBP1-83460)

Discover related pathways, diseases and genes to CCDC38 Antibody (NBP1-83460). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCDC38 Antibody (NBP1-83460)

Discover more about diseases related to CCDC38 Antibody (NBP1-83460).

Blogs on CCDC38

There are no specific blogs for CCDC38, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCDC38 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCDC38