CCDC38 Antibody

Images

 
Immunohistochemistry: CCDC38 Antibody [NBP1-81919] - Staining of human placenta shows strong cytoplasmic positivity in decidual cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

CCDC38 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LLPTLNSGGKVKDGSTKEDRPYKIFFRDLFLVKENEMAAKETEKFMNRNMKVYQKTTFSSRMKSHSYLSQLAFYPKRSGRSFEKFGPGPA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCDC38
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For HIER pH6 retrieval is recommended.
Control Peptide
CCDC38 Protein (NBP1-81919PEP)
Publications
Read Publication using
NBP1-81919 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24786987).

Alternate Names for CCDC38 Antibody

  • coiled-coil domain containing 38
  • coiled-coil domain-containing protein 38
  • FLJ40089

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7506
Species: Hu
Applications: WB
NBP2-14802
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88680
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88730
Species: Hu
Applications: IHC, IHC-P
NB200-323
Species: Hu, Rt
Applications: WB
AF4977
Species: Mu
Applications: WB
NBP2-45600
Species: Hu, Ca, Mk
Applications: WB, IHC, IF
NBP1-31566
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB197
Species: Hu
Applications: Flow, ICC, Neut
NB100-56341
Species: Hu
Applications: WB, ChIP, IP
NBP1-83493
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38146
Species: Hu
Applications: IHC, IHC-P
H00010438-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for CCDC38 Antibody (NBP1-81919)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for CCDC38 Antibody (NBP1-81919) (0)

There are no reviews for CCDC38 Antibody (NBP1-81919). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CCDC38 Antibody (NBP1-81919) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CCDC38 Antibody Products

Related Products by Gene

Bioinformatics Tool for CCDC38 Antibody (NBP1-81919)

Discover related pathways, diseases and genes to CCDC38 Antibody (NBP1-81919). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCDC38 Antibody (NBP1-81919)

Discover more about diseases related to CCDC38 Antibody (NBP1-81919).

Blogs on CCDC38

There are no specific blogs for CCDC38, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol CCDC38

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-81919 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought