CCDC38 Antibody

Images

 
Immunohistochemistry: CCDC38 Antibody [NBP1-81919] - Staining of human placenta shows strong cytoplasmic positivity in decidua cells.

Product Details

Summary
Product Discontinued
View other related CCDC38 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-81919
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

CCDC38 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LLPTLNSGGKVKDGSTKEDRPYKIFFRDLFLVKENEMAAKETEKFMNRNMKVYQKTTFSSRMKSHSYLSQLAFYPKRSGRSFEKFGPGPA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCDC38
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For HIER pH6 retrieval is recommended.
Publications
Read Publication using
NBP1-81919 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24786987).

Alternate Names for CCDC38 Antibody

  • coiled-coil domain containing 38
  • coiled-coil domain-containing protein 38
  • FLJ40089

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7506
Species: Hu
Applications: WB
NBP2-14802
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88680
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88730
Species: Hu
Applications: IHC, IHC-P
NBP1-81776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
AF4977
Species: Mu
Applications: WB
NBP2-45600
Species: Hu, Ca, Mk
Applications: WB, IHC, IF
NBP1-31566
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB9161
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
MAB197
Species: Hu
Applications: Flow, CyTOF-reported, ICC, Neut
NBP2-22151
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-83493
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38146
Species: Hu
Applications: IHC, IHC-P
H00010438-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for CCDC38 Antibody (NBP1-81919)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for CCDC38 Antibody (NBP1-81919) (0)

There are no reviews for CCDC38 Antibody (NBP1-81919). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CCDC38 Antibody (NBP1-81919) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CCDC38 Antibody Products

CCDC38 NBP1-81919

Related Products by Gene

Bioinformatics Tool for CCDC38 Antibody (NBP1-81919)

Discover related pathways, diseases and genes to CCDC38 Antibody (NBP1-81919). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCDC38 Antibody (NBP1-81919)

Discover more about diseases related to CCDC38 Antibody (NBP1-81919).

Blogs on CCDC38

There are no specific blogs for CCDC38, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our CCDC38 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCDC38