CCDC148 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CCDC148 Antibody [NBP1-81217] - Staining of human cell line A-431 shows positivity in nucleoli and nucleus but not nucleoli.
Immunohistochemistry-Paraffin: CCDC148 Antibody [NBP1-81217] - Staining of human vulva/anal skin shows strong cytoplasmic positivity in epidermal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

CCDC148 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SRHDLVEHEKYCDQYRFAIEQQNILISNWNKNRKDFIQKAVLTLTEACATHEMESMLAKDKKKQQELCADLKAKVRQWRAHQEEVARLEME
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCDC148
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For HIER pH6 retrieval is recommended.
Control Peptide
CCDC148 Protein (NBP1-81217PEP)

Alternate Names for CCDC148 Antibody

  • coiled-coil domain containing 148
  • coiled-coil domain-containing protein 148
  • MGC125588
  • MGC125590

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
PPS021
Species: Hu, Mu, Rt, Ca, Pm, Ze
Applications: WB
H00011320-M02
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-84758
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83984
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF-242-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-81844
Species: Hu
Applications: IHC, IHC-P
H00064326-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP2-31837
Species: Hu
Applications: IHC, IHC-P
H00023415-R03
Species: Hu
NBP1-87104
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15452
Species: Hu, Ch
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30646
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-91048
Species: Hu
Applications: IHC, IHC-P
NBP2-13248
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33500
Species: Mu, Rt
Applications: WB, IHC, IHC-Fr

Publications for CCDC148 Antibody (NBP1-81217) (0)

There are no publications for CCDC148 Antibody (NBP1-81217).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCDC148 Antibody (NBP1-81217) (0)

There are no reviews for CCDC148 Antibody (NBP1-81217). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CCDC148 Antibody (NBP1-81217) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CCDC148 Antibody Products

Related Products by Gene

Bioinformatics Tool for CCDC148 Antibody (NBP1-81217)

Discover related pathways, diseases and genes to CCDC148 Antibody (NBP1-81217). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCDC148 Antibody (NBP1-81217)

Discover more about diseases related to CCDC148 Antibody (NBP1-81217).

Blogs on CCDC148

There are no specific blogs for CCDC148, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our CCDC148 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCDC148

Customers Who Bought This Also Bought