CCDC144A Antibody


Immunohistochemistry: CCDC144A Antibody [NBP2-48881] - Staining of human pancreas shows strong cytoplasmic positivity in islets of Langerhans.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

CCDC144A Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: DKCPSVSPSMPENQSATKELGQMNLTEREKMDTGVVLLSGNDTLHDLCQSQLPE
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CCDC144A Recombinant Protein Antigen (NBP2-48881PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CCDC144A Antibody

  • coiled-coil domain containing 144A
  • coiled-coil domain-containing protein 144A
  • FLJ43983


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CCDC144A Antibody (NBP2-48881) (0)

There are no publications for CCDC144A Antibody (NBP2-48881).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCDC144A Antibody (NBP2-48881) (0)

There are no reviews for CCDC144A Antibody (NBP2-48881). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CCDC144A Antibody (NBP2-48881) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CCDC144A Products

Bioinformatics Tool for CCDC144A Antibody (NBP2-48881)

Discover related pathways, diseases and genes to CCDC144A Antibody (NBP2-48881). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on CCDC144A

There are no specific blogs for CCDC144A, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CCDC144A Antibody and receive a gift card or discount.


Gene Symbol CCDC144A