CCDC135 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CCDC135 Antibody [NBP1-88451] - Staining of human cell line U-251 MG shows positivity in nucleoli.
Immunohistochemistry-Paraffin: CCDC135 Antibody [NBP1-88451] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CCDC135 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VPENFFIDPFTGHSYSTQDEHFLGIESLWNHKNYWINMQDCWNCCKDLIFDLGDPVRWEYMLLGTDKSQLSLTEEDDSGINDEDDVENLGKE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCDC135
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CCDC135 Protein (NBP1-88451PEP)
Publications
Read Publication using NBP1-88451.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (82%). Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CCDC135 Antibody

  • C16orf50
  • chromosome 16 open reading frame 50
  • coiled-coil domain containing 135
  • coiled-coil domain-containing protein 135
  • DKFZp434I099

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02984
Species: Hu, Rt, Ca, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-15309
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80944
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-39059
Species: Hu
Applications: IHC, IHC-P
NBP1-92123
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15738
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13249
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57533
Species: Hu
Applications: ICC/IF
NBP1-88472
Species: Hu
Applications: IHC, IHC-P
NBP1-88691
Species: Hu
Applications: WB, IHC, IHC-P
H00004867-D01P
Species: Hu, Mu
Applications: WB
NBP1-94074
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-P
NBP1-84403
Species: Hu
Applications: IHC, IHC-P
NBP1-93673
Species: Hu
Applications: IHC, IHC-P

Publications for CCDC135 Antibody (NBP1-88451)(1)

Reviews for CCDC135 Antibody (NBP1-88451) (0)

There are no reviews for CCDC135 Antibody (NBP1-88451). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CCDC135 Antibody (NBP1-88451) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CCDC135 Products

Bioinformatics Tool for CCDC135 Antibody (NBP1-88451)

Discover related pathways, diseases and genes to CCDC135 Antibody (NBP1-88451). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCDC135 Antibody (NBP1-88451)

Discover more about diseases related to CCDC135 Antibody (NBP1-88451).
 

Pathways for CCDC135 Antibody (NBP1-88451)

View related products by pathway.

PTMs for CCDC135 Antibody (NBP1-88451)

Learn more about PTMs related to CCDC135 Antibody (NBP1-88451).

Blogs on CCDC135

There are no specific blogs for CCDC135, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCDC135 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCDC135