CCBE1 Antibody


Western Blot: CCBE1 Antibody [NBP1-83544] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: CCBE1 Antibody [NBP1-83544] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli, plasma membrane & cytosol.
Immunohistochemistry-Paraffin: CCBE1 Antibody [NBP1-83544] - Staining of human kidney shows strong membranous positivity in cells in tubules and cells in glomeruli.
Western Blot: CCBE1 Antibody [NBP1-83544] - Analysis in human ovary tissue.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

CCBE1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: PGSFDFLLLMLADIRNDITELQEKVFGHRTHSSAEEFPLPQEFPSYPEAMDLGSGDDHPRRTETRDLRA
Specificity of human, mouse, rat CCBE1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CCBE1 Protein (NBP1-83544PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CCBE1 Antibody

  • collagen and calcium binding EGF domains 1
  • collagen and calcium-binding EGF domain-containing protein 1
  • Full of fluid protein homolog
  • KIAA1983FLJ30681
  • MGC50861


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Simple Western, ICC
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, IHC, IP
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: IHC
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: WB, Flow, CyTOF-ready
Species: Hu
Applications: WB, ChIP, ICC

Publications for CCBE1 Antibody (NBP1-83544) (0)

There are no publications for CCBE1 Antibody (NBP1-83544).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCBE1 Antibody (NBP1-83544) (0)

There are no reviews for CCBE1 Antibody (NBP1-83544). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CCBE1 Antibody (NBP1-83544) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CCBE1 Products

Bioinformatics Tool for CCBE1 Antibody (NBP1-83544)

Discover related pathways, diseases and genes to CCBE1 Antibody (NBP1-83544). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCBE1 Antibody (NBP1-83544)

Discover more about diseases related to CCBE1 Antibody (NBP1-83544).

Pathways for CCBE1 Antibody (NBP1-83544)

View related products by pathway.

PTMs for CCBE1 Antibody (NBP1-83544)

Learn more about PTMs related to CCBE1 Antibody (NBP1-83544).

Blogs on CCBE1

There are no specific blogs for CCBE1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CCBE1 Antibody and receive a gift card or discount.


Gene Symbol CCBE1