CBS Antibody (6B8)

Images

 
Immunohistochemistry-Paraffin: CBS Antibody (6B8) [H00000875-M05] - Analysis of monoclonal antibody to CBS on formalin-fixed paraffin-embedded human liver. Antibody concentration 3 ug/ml
Sandwich ELISA: CBS Antibody (6B8) [H00000875-M05] - Detection limit for recombinant GST tagged CBS is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Product Discontinued
View other related CBS Primary Antibodies

Order Details


    • Catalog Number
      H00000875-M05
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

CBS Antibody (6B8) Summary

Immunogen
CBS (NP_000062, 1 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFG
Specificity
CBS - cystathionine-beta-synthase (6B8)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CBS
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. It has been used for IHC-P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CBS Antibody (6B8)

  • cystathionine-beta-synthase
  • EC 4.2.1.2210Beta-thionase

Background

The protein encoded by this gene is involved in the transsulfuration pathway. The first step of this pathway, from homocysteine to cystathionine, is catalyzed by this protein. CBS deficiency can cause homocystinuria which affects many organs and tissues, including the eyes and the skeletal, vascular and central nervous systems. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37607
Species: Hu, Rt
Applications: WB, ELISA, IHC
H00001491-M01
Species: Hu, GP
Applications: WB, ELISA
NB100-791
Species: Hu
Applications: WB, IHC, PEP-ELISA
NBP1-84037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-57749
Species: Hu
Applications: WB, IHC
AF1640
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ELISA(Sta)
AF4309
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-27461
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-87781
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02349
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE

Publications for CBS Antibody (H00000875-M05) (0)

There are no publications for CBS Antibody (H00000875-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CBS Antibody (H00000875-M05) (0)

There are no reviews for CBS Antibody (H00000875-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CBS Antibody (H00000875-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CBS Products

Bioinformatics Tool for CBS Antibody (H00000875-M05)

Discover related pathways, diseases and genes to CBS Antibody (H00000875-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CBS Antibody (H00000875-M05)

Discover more about diseases related to CBS Antibody (H00000875-M05).
 

Pathways for CBS Antibody (H00000875-M05)

View related products by pathway.

PTMs for CBS Antibody (H00000875-M05)

Learn more about PTMs related to CBS Antibody (H00000875-M05).
 

Research Areas for CBS Antibody (H00000875-M05)

Find related products by research area.

Blogs on CBS

There are no specific blogs for CBS, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CBS Antibody (6B8) and receive a gift card or discount.

Bioinformatics

Gene Symbol CBS
Entrez
Uniprot