Caveolin-2 Antibody - BSA Free

Western Blot: Caveolin-2 Antibody [NBP2-33431] - Analysis in human cell lines A-431 and MCF-7 using anti-CAV2 antibody. Corresponding CAV2 RNA-seq data are presented for the same cell lines. Loading control: anti-PPIB.

Immunocytochemistry/Immunofluorescence: Caveolin-2 Antibody [NBP2-33431] - Immunofluorescent staining of human cell line A-431 shows localization to vesicles.

Immunohistochemistry-Paraffin: Caveolin-2 Antibody [NBP2-33431] - Staining in human lung and pancreas tissues using anti-CAV2 antibody. Corresponding CAV2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Caveolin-2 Antibody [NBP2-33431] - Staining of human lung shows strong cytoplasmic and membranous positivity in pneumocytes.

Immunohistochemistry-Paraffin: Caveolin-2 Antibody [NBP2-33431] - Staining of human pancreas shows low expression as expected.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Caveolin-2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Caveolin-2 Antibody - BSA Free (NBP2-33431) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Caveolin-2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GLETEKADVQLFMDDDSYSHHSGLEYADPEKFADSDQDRDPHRLNSHLKLGFEDVIA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CAV2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Caveolin-2 Protein (NBP2-33431PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (82%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Caveolin-2 Antibody - BSA Free

• CAV
• CAV2
• caveolae protein, 20-kD
• caveolin 2 isoform a and b
• caveolin 2
• Caveolin2
• Caveolin-2
• MGC12294

Background

Caveolae are cholesterol/sphingolipid-rich microdomains of the plasma membrane that have been implicated in signal transduction and vesicular trafficking. Caveolins are a family of caveolae-associated integral membrane proteins (1). Caveolin, a 21- to 24-kDa integral membrane protein, is a principal component of caveolae membranes. Caveolin interacts directly with heterotrimeric guanine nucleotide binding proteins (G proteins) and can functionally regulate their activity. Caveolins 1 and 2 are similar in most respects, however, caveolin-1 and caveolin-2 differ in their functional interactions with heterotrimeric G proteins, possibly explaining why caveolin-1 and -2 are coexpressed within a single cell (2). Caveolin-2 is up-regulated in response to the mechanical injury of differentiated PC12 cells; up-regulation of caveolin-2 under these conditions is strictly dependent on continued treatment with NGF. Robust expression of caveolin-1 and -2 is also observed along the entire cell surface of DRG neurons, including high levels on growth cones. These findings demonstrate that neuronal cells express caveolins (1).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Caveolin-2 Antibody (NBP2-33431)(1)

Publication using NBP2-33431

• Codenotti S, Vezzoli M, Poliani PL et al. Caveolin-1, Caveolin-2 and Cavin-1 are strong predictors of adipogenic differentiation in human tumors and cell lines of liposarcoma. Eur. J. Cell Biol. 2016-05-04 [PMID: 27168348] (IHC-P, Human)

Bioinformatics

• Gene Symbol: CAV2
• Uniprot:
  • P51636()