Cathepsin Z Antibody


Western Blot: Cathepsin Z Antibody [NBP2-38614] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line CACO-2
Immunocytochemistry/ Immunofluorescence: Cathepsin Z Antibody [NBP2-38614] - Immunofluorescent staining of human cell line A-431 shows localization to vesicles.
Immunohistochemistry-Paraffin: Cathepsin Z Antibody [NBP2-38614] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.
Simple Western: Cathepsin Z Antibody [NBP2-38614] - Simple Western lane view shows a specific band for Cathepsin Z in 0.2 mg/ml of SW480 lysate(s). This experiment was performed under reducing conditions using the more
Simple Western: Cathepsin Z Antibody [NBP2-38614] - Electropherogram image of the corresponding Simple Western lane view. Cathepsin Z antibody was used at 1:10 dilution on SW480 lysate(s) respectively.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P

Order Details

Cathepsin Z Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: PDETCNNYQAKDQECDKFNQCGTCNEFKECHAIRNYTLWRVGDYGSLSGREKMMAEIYANGPISCGIMATERLANYTGGIYAEYQD
Specificity of human Cathepsin Z antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (92%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Simple Western 1:10
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Cathepsin Z Protein (NBP2-38614PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Cathepsin Z Antibody

  • Cathepsin P
  • Cathepsin X
  • cathepsin Z
  • CTSX
  • EC
  • FLJ17088
  • preprocathepsin P


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Po, Ch, Rb
Applications: WB, IHC, IP
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
Species: Hu
Applications: WB, Simple Western, IHC, IP, KO
Species: Hu
Applications: Flow, AdBlk, CyTOF-ready, ICC
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, IHC, IP
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Mu
Applications: WB, IHC, IP
Species: Hu
Applications: WB, IHC, IP
Species: Hu
Applications: Flow, IP, CyTOF-ready
Species: Mu
Applications: WB, IHC
Species: Mu
Applications: Flow, CyTOF-ready
Species: Hu
Species: Hu, Mu, Rt, Bv
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Single Cell Western
Species: Mu, Rt
Applications: WB, Simple Western, IHC
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Cathepsin Z Antibody (NBP2-38614) (0)

There are no publications for Cathepsin Z Antibody (NBP2-38614).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cathepsin Z Antibody (NBP2-38614) (0)

There are no reviews for Cathepsin Z Antibody (NBP2-38614). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Cathepsin Z Antibody (NBP2-38614) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Cathepsin Z Antibody (NBP2-38614)

Discover related pathways, diseases and genes to Cathepsin Z Antibody (NBP2-38614). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cathepsin Z Antibody (NBP2-38614)

Discover more about diseases related to Cathepsin Z Antibody (NBP2-38614).

Pathways for Cathepsin Z Antibody (NBP2-38614)

View related products by pathway.

Blogs on Cathepsin Z

There are no specific blogs for Cathepsin Z, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Cathepsin Z Antibody and receive a gift card or discount.


Gene Symbol CTSZ