Cathepsin Z Antibody

Images

 
Western Blot: Cathepsin Z Antibody [H00001522-B02P] - Analysis of CTSZ expression in human liver.
Western Blot: Cathepsin Z Antibody [H00001522-B02P] - Analysis of CTSZ expression in transfected 293T cell line by CTSZ polyclonal antibody. Lane 1: CTSZ transfected lysate(33.33 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Cathepsin Z Antibody Summary

Immunogen
CTSZ (NP_001327.2, 1 a.a. - 303 a.a.) full-length human protein. MARRGPGWRPLLLLVLLAGAAQGGLYFRRGQTCYRPLRGDGLAPLGRSTYPRPHEYLSPADLPKSWDWRNVDGVNYASITRNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSVQNVIDCGNAGSCEGGNDLSVWDYAHQHGIPDETCNNYQAKDQECDKFNQCGTCNEFKECHAIRNYTLWRVGDYGSLSGREKMMAEIYANGPISCGIMATERLANYTGGIYAEYQDTTYINHVVSVAGWGISDGTEYWIVRNSWGEPWGERGWLRIVTSTYKDGKGARYNLAIEEHCTFGDPIV
Specificity
CTSZ - cathepsin Z,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
CTSZ
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cathepsin Z Antibody

  • Cathepsin P
  • Cathepsin X
  • cathepsin Z
  • CTSX
  • EC 3.4.18.1
  • FLJ17088
  • preprocathepsin P

Background

The protein encoded by this gene is a lysosomal cysteine proteinase and member of the peptidase C1 family. It exhibits both carboxy-monopeptidase and carboxy-dipeptidase activities. The encoded protein has also been known as cathepsin X and cathepsin P. This gene is expressed ubiquitously in cancer cell lines and primary tumors and, like other members of this family, may be involved in tumorigenesis. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001513-M01
Species: Hu
Applications: WB, ELISA, IHC-P
AF952
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
AF953
Species: Hu
Applications: WB, Simple Western, IHC, IP
NB200-610
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
NBP2-03381
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1029
Species: Mu
Applications: WB, IHC, IP
AF1183
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF1013
Species: Mu
Applications: WB, IHC, IP
AF2075
Species: Hu
Applications: WB, IHC, IP
NB500-328
Species: Hu
Applications: Flow, IP, CyTOF-ready
AF2556
Species: Mu
Applications: WB, IHC
MAB3737
Species: Mu
Applications: Flow, CyTOF-ready
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF1034
Species: Mu, Rt
Applications: WB, Simple Western, IHC
AF1008
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2898
Species: Mu
Applications: WB, IP
H00001522-B02P
Species: Hu
Applications: WB

Publications for Cathepsin Z Antibody (H00001522-B02P) (0)

There are no publications for Cathepsin Z Antibody (H00001522-B02P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cathepsin Z Antibody (H00001522-B02P) (0)

There are no reviews for Cathepsin Z Antibody (H00001522-B02P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cathepsin Z Antibody (H00001522-B02P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cathepsin Z Products

Bioinformatics Tool for Cathepsin Z Antibody (H00001522-B02P)

Discover related pathways, diseases and genes to Cathepsin Z Antibody (H00001522-B02P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cathepsin Z Antibody (H00001522-B02P)

Discover more about diseases related to Cathepsin Z Antibody (H00001522-B02P).
 

Pathways for Cathepsin Z Antibody (H00001522-B02P)

View related products by pathway.

Blogs on Cathepsin Z

There are no specific blogs for Cathepsin Z, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cathepsin Z Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CTSZ
Entrez
Uniprot