Cathepsin S Antibody Summary
| Description |
Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen |
CTSS (NP_004070.3, 1 a.a. - 331 a.a.) full-length human protein. MKRLVCVLLVCSSAVAQLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHNLEHSMGMHSYDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNRILPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI |
| Specificity |
CTSS, |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CTSS |
| Purity |
Protein A purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
It has been used for ELISA and WB. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Protein A purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Cathepsin S Antibody
Background
The protein encoded by this gene, a member of the peptidase C1 family, is a lysosomal cysteine proteinase that may participate in the degradation of antigenic proteins to peptides for presentation on MHC class II molecules. The encoded protein can function as an elastase over a broad pH range in alveolar macrophages. Transcript variants utilizing alternative polyadenylation signals exist for this gene. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: IHC, Neut, WB
Species: Mu, Rt
Applications: ELISA
Species: Mu
Applications: IHC, IP, WB
Species: Bv, Fe, Hu, Rb
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: BA
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Mu
Applications: BA
Species: Hu
Applications: ELISA
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Mu
Applications: ELISA
Species: Mu
Applications: ICC, IHC, IP, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: WB
Publications for Cathepsin S Antibody (H00001520-D01P) (0)
There are no publications for Cathepsin S Antibody (H00001520-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Cathepsin S Antibody (H00001520-D01P) (0)
There are no reviews for Cathepsin S Antibody (H00001520-D01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Cathepsin S Antibody (H00001520-D01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Cathepsin S Products
Blogs on Cathepsin S