Recombinant Human Cathepsin H Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Cathepsin H Peptides and Proteins

Order Details


    • Catalog Number
      H00001512-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Cathepsin H Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-335 of Human CTSH full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MWATLPLLCAGAWLLGVPVCGAAELCVNSLEKFHFKSWMSKHRKTYSTEEYHHRLQTFASNWRKINAHNNGNHTFKMALNQFSDMSFAEIKHKYLWSEPQNCSATKSNYLRGTGPYPPSVDWRKKGNFVSPVKNQGACGSCWTFSTTGALESAIAIATGKMLSLAEQQLVDCAQDFNNHGCQGGLPSQAFEYILYNKGIMGEDTYPYQGKDGYCKFQPGKAIGFVKDVANITIYDEEAMVEAVALYNPVSFAFEVTQDFMMYRTGIYSSTSCHKTPDKVNHAVLAVGYGEKNGIPYWIVKNSWGPQWGMNGYFLIERGKNMCGLAACASYPIPLV

Protein/Peptide Type
Recombinant Protein
Gene
CTSH

Applications/Dilutions

Application Notes
Western blot, ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Cathepsin H Protein

  • ACC-4
  • ACC-5
  • aleurain
  • cathepsin B3
  • cathepsin BA
  • Cathepsin H
  • CPSB
  • CTSH
  • DKFZp686B24257
  • EC 3.4.22
  • EC 3.4.22.16
  • MGC1519
  • minichain
  • N-benzoylarginine-beta-naphthylamide hydrolase

Background

The protein encoded by this gene is a lysosomal cysteine proteinase important in the overall degradation of lysosomal proteins. It is composed of a dimer of disulfide-linked heavy and light chains, both produced from a single protein precursor. The encoded protein, which belongs to the peptidase C1 protein family, can act both as an aminopeptidase and as an endopeptidase. Increased expression of this gene has been correlated with malignant progression of prostate tumors. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF952
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
AF953
Species: Hu
Applications: WB, Simple Western, IHC, IP
AF1029
Species: Mu
Applications: WB, IHC, IP
AF1183
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
H00001513-M01
Species: Hu
Applications: WB, ELISA, IHC-P
AF1286
Species: Hu
Applications: WB, Simple Western, IHC, IP
AF1034
Species: Mu, Rt
Applications: WB, Simple Western, IHC
AF1408
Species: Hu, Rt
Applications: WB, Simple Western, IHC, IP
1407-PI
Species: Hu
1202-PI
Species: Hu
1407-PI
Species: Hu
NBP1-57977
Species: Hu
Applications: WB, IHC
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
NBP1-84986
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-87201
Species: Hu
Applications: WB, IHC, IHC-P
H00001512-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for Cathepsin H Recombinant Protein (H00001512-P01) (0)

There are no publications for Cathepsin H Recombinant Protein (H00001512-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cathepsin H Recombinant Protein (H00001512-P01) (0)

There are no reviews for Cathepsin H Recombinant Protein (H00001512-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cathepsin H Recombinant Protein (H00001512-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cathepsin H Products

Bioinformatics Tool for Cathepsin H Recombinant Protein (H00001512-P01)

Discover related pathways, diseases and genes to Cathepsin H Recombinant Protein (H00001512-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cathepsin H Recombinant Protein (H00001512-P01)

Discover more about diseases related to Cathepsin H Recombinant Protein (H00001512-P01).
 

Pathways for Cathepsin H Recombinant Protein (H00001512-P01)

View related products by pathway.

PTMs for Cathepsin H Recombinant Protein (H00001512-P01)

Learn more about PTMs related to Cathepsin H Recombinant Protein (H00001512-P01).
 

Research Areas for Cathepsin H Recombinant Protein (H00001512-P01)

Find related products by research area.

Blogs on Cathepsin H

There are no specific blogs for Cathepsin H, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Cathepsin H Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CTSH
Entrez