Recombinant Human Cathepsin G GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human Cathepsin G Protein [H00001511-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Cathepsin G GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 146-255 of Human Cathepsin G

Source: Wheat Germ (in vitro)

Amino Acid Sequence: GWGRVSMRRGTDTLREVQLRVQRDRQCLRIFGSYDPRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPPEVFTRVSSFLPWIRTTMRSFKLLDQMETPL

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
CTSG
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
37.95 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using
H00001511-Q01 in the following applications:

  • WB
    2 publications

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Cathepsin G GST (N-Term) Protein

  • cathepsin G
  • CathepsinG
  • CGCATG
  • EC 3.4.21
  • EC 3.4.21.20
  • MGC23078

Background

CTSG - cathepsin G

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP1-25966
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
NBP2-38770
Species: Hu, Mu
Applications: WB
NB600-930
Species: Hu, Rt
Applications: WB, ELISA
NB120-10109
Species: Hu
Applications: WB, Flow, IHC, IHC-P, S-ELISA, CyTOF-ready
NB100-62346
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-58917
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-2076
Species: Hu, Po, Ca, Fe, Gt, Gp, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF2200
Species: Hu
Applications: WB, IP
AF1034
Species: Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-91258
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
H00001511-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for Cathepsin G Partial Recombinant Protein (H00001511-Q01)(4)

Reviews for Cathepsin G Partial Recombinant Protein (H00001511-Q01) (0)

There are no reviews for Cathepsin G Partial Recombinant Protein (H00001511-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cathepsin G Partial Recombinant Protein (H00001511-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional Cathepsin G Products

Bioinformatics Tool for Cathepsin G Partial Recombinant Protein (H00001511-Q01)

Discover related pathways, diseases and genes to Cathepsin G Partial Recombinant Protein (H00001511-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cathepsin G Partial Recombinant Protein (H00001511-Q01)

Discover more about diseases related to Cathepsin G Partial Recombinant Protein (H00001511-Q01).
 

Pathways for Cathepsin G Partial Recombinant Protein (H00001511-Q01)

View related products by pathway.

PTMs for Cathepsin G Partial Recombinant Protein (H00001511-Q01)

Learn more about PTMs related to Cathepsin G Partial Recombinant Protein (H00001511-Q01).

Blogs on Cathepsin G

There are no specific blogs for Cathepsin G, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Cathepsin G GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CTSG