Cathepsin E Antibody

Images

 
Western Blot: Cathepsin E Antibody [NBP1-79789] - Human Placenta Lysate 1ug/ml Gel Concentration 12%

Product Details

Summary
Product Discontinued
View other related Cathepsin E Primary Antibodies

Order Details


    • Catalog Number
      NBP1-79789
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Cathepsin E Antibody Summary

Immunogen
The specific Immunogen is proprietary information. Peptide sequence GILGLGYPSLAVGGVTPVFDNMMAQNLVDLPMFSVYMSSNPEGGAGSELI.
Clonality
Polyclonal
Host
Rabbit
Gene
CTSE
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against CTSE and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Cathepsin E Antibody

  • CATE
  • Cathepsin E
  • CTSE
  • EC 3.4.23
  • EC 3.4.23.34
  • erythrocyte membrane aspartic proteinase
  • slow-moving proteinase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1029
Species: Mu
Applications: WB, IHC, IP
NBP1-91012
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-55298
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
AF953
Species: Hu
Applications: WB, Simple Western, IHC, IP
NB600-922
Species: Ch, Vi
Applications: WB, ELISA, IHC, IHC-P, IP
AF952
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP2-22217
Species: Hu, Mu, Rt(-)
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NB120-19294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-62346
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-79789
Species: Hu
Applications: WB

Publications for Cathepsin E Antibody (NBP1-79789) (0)

There are no publications for Cathepsin E Antibody (NBP1-79789).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cathepsin E Antibody (NBP1-79789) (0)

There are no reviews for Cathepsin E Antibody (NBP1-79789). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cathepsin E Antibody (NBP1-79789) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Cathepsin E Antibody (NBP1-79789)

Discover related pathways, diseases and genes to Cathepsin E Antibody (NBP1-79789). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cathepsin E Antibody (NBP1-79789)

Discover more about diseases related to Cathepsin E Antibody (NBP1-79789).
 

Pathways for Cathepsin E Antibody (NBP1-79789)

View related products by pathway.

PTMs for Cathepsin E Antibody (NBP1-79789)

Learn more about PTMs related to Cathepsin E Antibody (NBP1-79789).
 

Research Areas for Cathepsin E Antibody (NBP1-79789)

Find related products by research area.

Blogs on Cathepsin E

There are no specific blogs for Cathepsin E, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cathepsin E Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CTSE
Entrez
Uniprot