Cathepsin D Antibody


Western Blot: Cathepsin D Antibody [NBP1-68918] - Titration: 0.2-1 ug/ml, Positive Control: Mouse Kidney.
Western Blot: Cathepsin D Antibody [NBP1-68918] - 20ug U937 Cell Lysate, Dilution: 1:1000 Secondary: Anti-Rabbit HRP at 1:2000 dilution
Western Blot: Cathepsin D Antibody [NBP1-68918] - Primary dilution: 1ug/mL Secondary dilution: 2mg/mL.

Product Details

Product Discontinued
View other related Cathepsin D Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Cathepsin D Antibody Summary

Synthetic peptides corresponding to Ctsd (cathepsin D) The peptide sequence was selected from the C terminal of Ctsd. Peptide sequence KTICLSGFMGMDIPPPSGPLWILGDVFIGSYYTVFDRDNNRVGFANAVVL.
Lysosomes Marker
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Ctsd and was validated on Western blot.
Theoretical MW
45 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Cathepsin D Antibody

  • cathepsin D (lysosomal aspartyl protease)
  • Cathepsin D
  • CPSD
  • CTSD
  • EC 3.4.23
  • EC
  • lysosomal aspartyl peptidase
  • lysosomal aspartyl protease
  • MGC2311
  • neuronal 10


Ctsd is an acid protease active in intracellular protein breakdown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Simple Western, IHC, IP
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, ICC
Species: Hu
Applications: WB, IHC, IP, Neut
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
Species: Mu
Applications: WB, IHC, IP
Species: Hu, Ba
Applications: WB, ELISA

Publications for Cathepsin D Antibody (NBP1-68918) (0)

There are no publications for Cathepsin D Antibody (NBP1-68918).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cathepsin D Antibody (NBP1-68918) (0)

There are no reviews for Cathepsin D Antibody (NBP1-68918). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cathepsin D Antibody (NBP1-68918) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Cathepsin D Products

Bioinformatics Tool for Cathepsin D Antibody (NBP1-68918)

Discover related pathways, diseases and genes to Cathepsin D Antibody (NBP1-68918). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cathepsin D Antibody (NBP1-68918)

Discover more about diseases related to Cathepsin D Antibody (NBP1-68918).

Pathways for Cathepsin D Antibody (NBP1-68918)

View related products by pathway.

PTMs for Cathepsin D Antibody (NBP1-68918)

Learn more about PTMs related to Cathepsin D Antibody (NBP1-68918).

Blogs on Cathepsin D

There are no specific blogs for Cathepsin D, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Cathepsin D Antibody and receive a gift card or discount.


Gene Symbol CTSD