Cathepsin D Antibody

Images

 
Western Blot: Cathepsin D Antibody [H00001509-B01P] - Analysis of CTSD expression in human pancreas.
Western Blot: Cathepsin D Antibody [H00001509-B01P] - Analysis of CTSD expression in A-431.
Western Blot: Cathepsin D Antibody [H00001509-B01P] - Analysis of CTSD expression in transfected 293T cell line by CTSD polyclonal antibody. Lane 1: CTSD transfected lysate(45.32 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Cathepsin D Antibody Summary

Immunogen
CTSD (AAH16320.1, 1 a.a. - 412 a.a.) full-length human protein. MQPSSLLPLALCLLAAPASALVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL
Marker
Lysosomes Marker
Specificity
CTSD - cathepsin D (lysosomal aspartyl peptidase),
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
CTSD
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cathepsin D Antibody

  • cathepsin D (lysosomal aspartyl protease)
  • Cathepsin D
  • CPSD
  • CTSD
  • EC 3.4.23
  • EC 3.4.23.5
  • lysosomal aspartyl peptidase
  • lysosomal aspartyl protease
  • MGC2311
  • neuronal 10

Background

This gene encodes a lysosomal aspartyl protease composed of a dimer of disulfide-linked heavy and light chains, both produced from a single protein precursor. This proteinase, which is a member of the peptidase C1 family, has a specificity similar to but narrower than that of pepsin A. Transcription of this gene is initiated from several sites, including one which is a start site for an estrogen-regulated transcript. Mutations in this gene are involved in the pathogenesis of several diseases, including breast cancer and possibly Alzheimer disease. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF953
Species: Hu
Applications: WB, Simple Western, IHC, IP
AF952
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-90813
Species: Hu
Applications: WB, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
AF6144
Species: Hu
Applications: WB, Simple Western
NB100-74512
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB120-19294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1310
Species: Hu
Applications: WB, IHC, IP
NB400-152
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
AF1013
Species: Mu
Applications: WB, IHC, IP
NB600-930
Species: Hu, Ba
Applications: WB, ELISA

Publications for Cathepsin D Antibody (H00001509-B01P) (0)

There are no publications for Cathepsin D Antibody (H00001509-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cathepsin D Antibody (H00001509-B01P) (0)

There are no reviews for Cathepsin D Antibody (H00001509-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cathepsin D Antibody (H00001509-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cathepsin D Products

Bioinformatics Tool for Cathepsin D Antibody (H00001509-B01P)

Discover related pathways, diseases and genes to Cathepsin D Antibody (H00001509-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cathepsin D Antibody (H00001509-B01P)

Discover more about diseases related to Cathepsin D Antibody (H00001509-B01P).
 

Pathways for Cathepsin D Antibody (H00001509-B01P)

View related products by pathway.

PTMs for Cathepsin D Antibody (H00001509-B01P)

Learn more about PTMs related to Cathepsin D Antibody (H00001509-B01P).
 

Research Areas for Cathepsin D Antibody (H00001509-B01P)

Find related products by research area.

Blogs on Cathepsin D

There are no specific blogs for Cathepsin D, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cathepsin D Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CTSD
Entrez
Uniprot