| Description | Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen | CTSB (NP_001899.1, 1 a.a. - 339 a.a.) full-length human protein. MWQLWASLCCLLVLANARSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKI |
| Specificity | CTSB - cathepsin B, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | CTSB |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Cathepsin B Antibody (H00001508-B01P)Find related products by research area.
|
|
Cathepsin B - a lysosomal protease with potential of an important drug target in neurological diseases and cancer Cathepsins are a family of lysosomal proteases (serine, aspartic and cysteine proteases) that acts in conjunction with lipases and nucleases to degrade biological macromolecules in the lysosomes (1). While most cathepsins are ubiquitously expressed... Read full blog post. |
|
Caspase 11: A novel non-canonical inflammasomes Cell death via apoptosis is a key cellular function triggered by the cell death receptor family and their ligands. This regulated process then transmits downstream signals through adaptor molecules ending with the caspase cysteine proteases. Caspas... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CTSB |
| Entrez |
|
| Uniprot |
|