Cathepsin B Antibody

Images

 
Western Blot: Cathepsin B Antibody [H00001508-B01P] - Analysis of CTSB expression in human liver.
Western Blot: Cathepsin B Antibody [H00001508-B01P] - Analysis of CTSB expression in transfected 293T cell line by CTSB polyclonal antibody. Lane 1: CTSB transfected lysate(37.29 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Cathepsin B Antibody Summary

Immunogen
CTSB (NP_001899.1, 1 a.a. - 339 a.a.) full-length human protein. MWQLWASLCCLLVLANARSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKI
Specificity
CTSB - cathepsin B,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
CTSB
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cathepsin B Antibody

  • APP secretase
  • APPS
  • Cathepsin B
  • Cathepsin B1
  • CPSBamyloid precursor protein secretase
  • CTSB
  • cysteine protease
  • EC 3.4.22
  • EC 3.4.22.1

Background

The protein encoded by this gene is a lysosomal cysteine proteinase composed of a dimer of disulfide-linked heavy and light chains, both produced from a single protein precursor. It is also known as amyloid precursor protein secretase and is involved in the proteolytic processing of amyloid precursor protein (APP). Incomplete proteolytic processing of APP has been suggested to be a causative factor in Alzheimer disease, the most common cause of dementia. Overexpression of the encoded protein, which is a member of the peptidase C1 family, has been associated with esophageal adenocarcinoma and other tumors. At least five transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF952
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
AF1029
Species: Mu
Applications: WB, IHC, IP
AF1013
Species: Mu
Applications: WB, IHC, IP
H00001513-M01
Species: Hu
Applications: WB, ELISA, IHC-P
AF1183
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF1310
Species: Hu
Applications: WB, IHC, IP
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
AF1286
Species: Hu
Applications: WB, Simple Western, IHC, IP
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
AF1034
Species: Mu, Rt
Applications: WB, Simple Western, IHC
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP2-12446
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE

Publications for Cathepsin B Antibody (H00001508-B01P) (0)

There are no publications for Cathepsin B Antibody (H00001508-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cathepsin B Antibody (H00001508-B01P) (0)

There are no reviews for Cathepsin B Antibody (H00001508-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cathepsin B Antibody (H00001508-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cathepsin B Products

Bioinformatics Tool for Cathepsin B Antibody (H00001508-B01P)

Discover related pathways, diseases and genes to Cathepsin B Antibody (H00001508-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cathepsin B Antibody (H00001508-B01P)

Discover more about diseases related to Cathepsin B Antibody (H00001508-B01P).
 

Pathways for Cathepsin B Antibody (H00001508-B01P)

View related products by pathway.

PTMs for Cathepsin B Antibody (H00001508-B01P)

Learn more about PTMs related to Cathepsin B Antibody (H00001508-B01P).
 

Research Areas for Cathepsin B Antibody (H00001508-B01P)

Find related products by research area.

Blogs on Cathepsin B.

Cathepsin B - a lysosomal protease with potential of an important drug target in neurological diseases and cancer
Cathepsins are a family of lysosomal proteases (serine, aspartic and cysteine proteases) that acts in conjunction with lipases and nucleases to degrade biological macromolecules in the lysosomes (1). While most cathepsins are ubiquitously expressed...  Read full blog post.

Caspase 11: A novel non-canonical inflammasomes
Cell death via apoptosis is a key cellular function triggered by the cell death receptor family and their ligands. This regulated process then transmits downstream signals through adaptor molecules ending with the caspase cysteine proteases. Caspas...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cathepsin B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CTSB
Entrez
Uniprot