Caspase-7 Antibody

Images

 
Western Blot: Caspase-7 Antibody [H00000840-B01P] - Analysis of CASP7 expression in transfected 293T cell line by CASP7 polyclonal antibody. Lane 1: CASP7 transfected lysate(33.33 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: Caspase-7 Antibody [H00000840-B01P] - Immunofluorescence of purified MaxPab antibody to CASP7 on HeLa cell. [antibody concentration 10 ug/ml]

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Caspase-7 Antibody Summary

Immunogen
CASP7 (NP_001218.1, 1 a.a. - 303 a.a.) full-length human protein. MADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ
Specificity
CASP7 - caspase 7, apoptosis-related cysteine peptidase,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
CASP7
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. It has been used for IF.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Caspase-7 Antibody

  • apoptosis-related cysteine protease
  • Apoptotic protease Mch-3
  • CASP7
  • CASP-7
  • caspase 7, apoptosis-related cysteine peptidase
  • Caspase7
  • Caspase-7
  • EC 3.4.22
  • EC 3.4.22.60
  • ICE-like apoptotic protease 3
  • Lice2 alpha/beta/gamma
  • Mch3

Background

This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. The precursor of this caspase is cleaved by caspase 3 and 10. It is activated upon cell death stimuli and induces apoptosis. Alternative splicing results in four transcript variants, encoding three distinct isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB100-56118
Species: Hu, Mu, Rt, Ca, Ge
Applications: IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56114
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP2-43728
Species: Hu
Applications: WB, ICC/IF
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
AF8221
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-56106
Species: Hu, Mu, Rt, Ca, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56565
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P

Publications for Caspase-7 Antibody (H00000840-B01P) (0)

There are no publications for Caspase-7 Antibody (H00000840-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Caspase-7 Antibody (H00000840-B01P) (0)

There are no reviews for Caspase-7 Antibody (H00000840-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Caspase-7 Antibody (H00000840-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Caspase-7 Products

Bioinformatics Tool for Caspase-7 Antibody (H00000840-B01P)

Discover related pathways, diseases and genes to Caspase-7 Antibody (H00000840-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Caspase-7 Antibody (H00000840-B01P)

Discover more about diseases related to Caspase-7 Antibody (H00000840-B01P).
 

Pathways for Caspase-7 Antibody (H00000840-B01P)

View related products by pathway.

PTMs for Caspase-7 Antibody (H00000840-B01P)

Learn more about PTMs related to Caspase-7 Antibody (H00000840-B01P).
 

Research Areas for Caspase-7 Antibody (H00000840-B01P)

Find related products by research area.

Blogs on Caspase-7.

Caspase 7 - A key effector of the apoptotic pathway
Caspase-7 is an effector caspase with important roles in mediating cell death signaling. As an effector caspase, caspase-7 is cleaved and activated by initiator caspases such as caspase-1 (1). Like other caspase family proteins, caspase-7 contains a...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Caspase-7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CASP7
Entrez
Uniprot