Recombinant Human Casein Kinase 2 beta Protein

Images

 
SDS-Page: Casein Kinase 2 beta Protein [NBC1-22577] - Casein Kinase 2B, 24.9kDa (215aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE

Product Details

Summary
Reactivity HuSpecies Glossary
Applications PAGE
Concentration
1 mg/ml

Order Details

Recombinant Human Casein Kinase 2 beta Protein Summary

Description
An un-tagged recombinant protein corresponding to amino acids 1 - 215 of CSNK2B.

Source: E.coli

Amino Acid Sequence: MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR

Source
E. coli
Protein/Peptide Type
Recombinant Protein
Gene
CSNK2B
Purity
>95% pure by SDS-PAGE

Applications/Dilutions

Theoretical MW
24.9 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
20mM Tris pH8.0, 10% glycerol, 0.2M NaCl, 1mM DTT, 1mM EDTA
Preservative
No Preservative
Concentration
1 mg/ml
Purity
>95% pure by SDS-PAGE

Alternate Names for Recombinant Human Casein Kinase 2 beta Protein

  • Casein Kinase 2 beta
  • casein kinase 2, beta polypeptide
  • Casein kinase II beta subunit
  • casein kinase II subunit beta
  • CK II beta
  • CK2B
  • CK2N
  • CSK2B
  • CSNK2B
  • G5A
  • MGC138222
  • MGC138224
  • Phosvitin
  • Protein G5a

Background

Casein Kinase 2 (CK2, also called PKCK2) is a ubiquitous Ser/Thr kinase expressed in all eukaryotes. CK2 is a tetramer composed of two catalytic kinase domains, alpha subunits, and two identical regulatory beta subunits. It has been implicated in cell cycle control, DNA repair, regulation of the circadian rhythm, and other cellular processes. The beta subunit itself does not have kinase activity, but confers stability to the CK2 alpha subunit and is involved in activity and substrate specificity. Recombinant human CK2beta was expressed in E.coli and purified by using conventional chromatography techniques.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00149420-P01
Species: Hu
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-922
Species: Ch, Vi
Applications: WB, ELISA, IHC, IHC-P, IP
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NB100-2720
Species: Hu
Applications: WB, IHC
MAB7957
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NB100-65220
Species: Hu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-91612
Species: Mu
Applications: WB
H00008349-M06
Species: Hu
Applications: ELISA, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBC1-22577
Species: Hu
Applications: PAGE

Publications for Casein Kinase 2 beta Protein (NBC1-22577) (0)

There are no publications for Casein Kinase 2 beta Protein (NBC1-22577).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Casein Kinase 2 beta Protein (NBC1-22577) (0)

There are no reviews for Casein Kinase 2 beta Protein (NBC1-22577). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for Casein Kinase 2 beta Protein (NBC1-22577) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Casein Kinase 2 beta Products

Bioinformatics Tool for Casein Kinase 2 beta Protein (NBC1-22577)

Discover related pathways, diseases and genes to Casein Kinase 2 beta Protein (NBC1-22577). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Casein Kinase 2 beta Protein (NBC1-22577)

Discover more about diseases related to Casein Kinase 2 beta Protein (NBC1-22577).
 

Pathways for Casein Kinase 2 beta Protein (NBC1-22577)

View related products by pathway.

PTMs for Casein Kinase 2 beta Protein (NBC1-22577)

Learn more about PTMs related to Casein Kinase 2 beta Protein (NBC1-22577).

Blogs on Casein Kinase 2 beta

There are no specific blogs for Casein Kinase 2 beta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Albumin Antibody
NB600-41532

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Casein Kinase 2 beta Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CSNK2B
Entrez