Casein Kinase 2 alpha Antibody (3D9) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related Casein Kinase 2 alpha Primary Antibodies

Order Details


    • Catalog Number
      H00001457-M01G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Casein Kinase 2 alpha Antibody (3D9) [DyLight 488] Summary

Immunogen
CSNK2A1 (AAH11668, 1 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADI
Specificity
CSNK2A1 (3D9)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CSNK2A1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Proximity Ligation Assay

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Casein Kinase 2 alpha Antibody (3D9) [DyLight 488]

  • Casein Kinase 2 alpha
  • casein kinase 2, alpha 1 polypeptide
  • casein kinase II alpha 1 subunit
  • CK II alpha
  • CK2 catalytic subunit alpha
  • CK2A1
  • CK2A1casein kinase II subunit alpha
  • CKII
  • CSNK2A1
  • EC 2.7.11
  • EC 2.7.11.1
  • protein kinase CK2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-60052
Species: Hu
Applications: WB
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-19751
Species: Hu
Applications: WB
NBP1-31541
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF

Publications for Casein Kinase 2 alpha Antibody (H00001457-M01G) (0)

There are no publications for Casein Kinase 2 alpha Antibody (H00001457-M01G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Casein Kinase 2 alpha Antibody (H00001457-M01G) (0)

There are no reviews for Casein Kinase 2 alpha Antibody (H00001457-M01G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Casein Kinase 2 alpha Antibody (H00001457-M01G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Casein Kinase 2 alpha Products

Bioinformatics Tool for Casein Kinase 2 alpha Antibody (H00001457-M01G)

Discover related pathways, diseases and genes to Casein Kinase 2 alpha Antibody (H00001457-M01G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Casein Kinase 2 alpha Antibody (H00001457-M01G)

Discover more about diseases related to Casein Kinase 2 alpha Antibody (H00001457-M01G).
 

Pathways for Casein Kinase 2 alpha Antibody (H00001457-M01G)

View related products by pathway.

Research Areas for Casein Kinase 2 alpha Antibody (H00001457-M01G)

Find related products by research area.

Blogs on Casein Kinase 2 alpha

There are no specific blogs for Casein Kinase 2 alpha, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Casein Kinase 2 alpha Antibody (3D9) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol CSNK2A1
Entrez