Recombinant Human Casein Kinase 1 gamma Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Casein Kinase 1 gamma Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 293-393 of Human Casein Kinase 1 gamma

Source: Wheat Germ

Amino Acid Sequence: KKGYTFDYAYDWVGRPIPTPVGSVHVDSGASAITRESHTHRDRPSQQQPLRNQVVSSTNGELNVDDPTGAHSNAPITAHAEVEVVEEAKCCCFFKRKRKKT

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
CSNK1G1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Casein Kinase 1 gamma Protein

  • Casein Kinase 1 gamma
  • casein kinase 1, gamma 1
  • casein kinase I isoform gamma-1
  • CKI-gamma 1
  • CSNK1G1
  • EC 2.7.11
  • EC 2.7.11.1

Background

CSNK1G1 - casein kinase 1, gamma 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29429
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, Flow-IC
NBP2-16020
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46627
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-18880
Species: Hu, Mu
Applications: WB, IP, PLA
NBP1-81046
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2364
Species: Hu
Applications: WB, IHC
NBP2-24529
Species: Hu, Mu, Ca, Ch, Pm
Applications: WB, Simple Western, IHC-P
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NB100-1669
Species: Hu
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP2-57641
Species: Hu
Applications: WB, ICC/IF
AF6947
Species: Hu
Applications: WB
H00027130-P02
Species: Hu
NB300-118
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP, ICC, IF
NB100-1888
Species: Hu, Mu, Rt
Applications: WB, IHC, PEP-ELISA
NBP1-40367
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP

Publications for Casein Kinase 1 gamma Partial Recombinant Protein (H00053944-Q01) (0)

There are no publications for Casein Kinase 1 gamma Partial Recombinant Protein (H00053944-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Casein Kinase 1 gamma Partial Recombinant Protein (H00053944-Q01) (0)

There are no reviews for Casein Kinase 1 gamma Partial Recombinant Protein (H00053944-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Casein Kinase 1 gamma Partial Recombinant Protein (H00053944-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Casein Kinase 1 gamma Products

Bioinformatics Tool for Casein Kinase 1 gamma Partial Recombinant Protein (H00053944-Q01)

Discover related pathways, diseases and genes to Casein Kinase 1 gamma Partial Recombinant Protein (H00053944-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Casein Kinase 1 gamma Partial Recombinant Protein (H00053944-Q01)

Discover more about diseases related to Casein Kinase 1 gamma Partial Recombinant Protein (H00053944-Q01).
 

Pathways for Casein Kinase 1 gamma Partial Recombinant Protein (H00053944-Q01)

View related products by pathway.

Research Areas for Casein Kinase 1 gamma Partial Recombinant Protein (H00053944-Q01)

Find related products by research area.

Blogs on Casein Kinase 1 gamma

There are no specific blogs for Casein Kinase 1 gamma, but you can read our latest blog posts.

Customers Who Bought This Also Bought

HDAC3 Antibody
NB100-1669

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Casein Kinase 1 gamma Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CSNK1G1
Entrez