Casein Kinase 1 epsilon Antibody


Western Blot: CSNK1E Antibody [NBP1-52951] - THP-1 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Product Discontinued
View other related Casein Kinase 1 epsilon Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Casein Kinase 1 epsilon Antibody Summary

Synthetic peptides corresponding to CSNK1E(casein kinase 1, epsilon) The peptide sequence was selected from the N terminal of CSNK1E. Peptide sequence MELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLH.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CSNK1E and was validated on Western blot.
Theoretical MW
47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Positive Control
Casein Kinase 1 epsilon Lysate (NBP2-64822)

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Casein Kinase 1 epsilon Antibody

  • Casein Kinase 1 epsilon
  • casein kinase 1, epsilon
  • casein kinase I isoform epsilon
  • CKIe
  • CKI-epsilon
  • CSNK1E
  • EC 2.7.11
  • EC
  • MGC10398


Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. CSNK1E can phosphorylate a large number of proteins. CSNK1E participates in Wnt signaling and is the central component of the circadian clock. It may act as a negative regulator of circadian rhythmicity by phosphorylating PER1 and PER2. CSNK1E inhibits cytokine-induced granuloytic differentiation.The protein encoded by this gene is a serine/threonine protein kinase and a member of the casein kinase I protein family, whose members have been implicated in the control of cytoplasmic and nuclear processes, including DNA replication and repair. The encoded protein is found in the cytoplasm as a monomer and can phosphorylate a variety of proteins, including itself. This protein has been shown to phosphorylate period, a circadian rhythm protein. Two transcript variants encoding the same protein have been found for this gene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Bv, Eq, Pm
Applications: WB, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu, Mu
Applications: WB, IHC, ICC
Species: Hu, Mu
Applications: WB, ChIP
Species: Hu

Publications for CSNK1E Antibody (NBP1-52951) (0)

There are no publications for CSNK1E Antibody (NBP1-52951).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CSNK1E Antibody (NBP1-52951) (0)

There are no reviews for CSNK1E Antibody (NBP1-52951). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CSNK1E Antibody (NBP1-52951) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Casein Kinase 1 epsilon Products

Bioinformatics Tool for CSNK1E Antibody (NBP1-52951)

Discover related pathways, diseases and genes to CSNK1E Antibody (NBP1-52951). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CSNK1E Antibody (NBP1-52951)

Discover more about diseases related to CSNK1E Antibody (NBP1-52951).

Pathways for CSNK1E Antibody (NBP1-52951)

View related products by pathway.

PTMs for CSNK1E Antibody (NBP1-52951)

Learn more about PTMs related to CSNK1E Antibody (NBP1-52951).

Research Areas for CSNK1E Antibody (NBP1-52951)

Find related products by research area.

Blogs on Casein Kinase 1 epsilon

There are no specific blogs for Casein Kinase 1 epsilon, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Casein Kinase 1 epsilon Antibody and receive a gift card or discount.


Gene Symbol CSNK1E