Recombinant Human CART/CARTPT Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CART/CARTPT Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-116 of Human CART full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MESSRVRLLPLLGAALLLMLPLLGTRAQEDAELQPRALDIYSAVDDASHEKELIEALQEVLKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
CARTPT

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CART/CARTPT Protein

  • CART prepropeptide
  • CART
  • CARTcocaine and amphetamine regulated transcript
  • CARTPT
  • cocaine- and amphetamine-regulated transcript protein

Background

CART( AAH29882, 1 a.a. - 117 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-35641
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-35703
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF636
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-56929
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-13780
Species: Hu
Applications: IHC, IHC-P
AF497
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
MAB763
Species: Hu, Mu, Rt
Applications: IHC
H00008767-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP2-34014
Species: Hu
Applications: IHC, IHC-P
MAB8200
Species: Hu, Mu
Applications: IHC
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)

Publications for CART/CARTPT Recombinant Protein (H00009607-P01) (0)

There are no publications for CART/CARTPT Recombinant Protein (H00009607-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CART/CARTPT Recombinant Protein (H00009607-P01) (0)

There are no reviews for CART/CARTPT Recombinant Protein (H00009607-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CART/CARTPT Recombinant Protein (H00009607-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CART/CARTPT Products

Bioinformatics Tool for CART/CARTPT Recombinant Protein (H00009607-P01)

Discover related pathways, diseases and genes to CART/CARTPT Recombinant Protein (H00009607-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CART/CARTPT Recombinant Protein (H00009607-P01)

Discover more about diseases related to CART/CARTPT Recombinant Protein (H00009607-P01).
 

Pathways for CART/CARTPT Recombinant Protein (H00009607-P01)

View related products by pathway.

PTMs for CART/CARTPT Recombinant Protein (H00009607-P01)

Learn more about PTMs related to CART/CARTPT Recombinant Protein (H00009607-P01).
 

Research Areas for CART/CARTPT Recombinant Protein (H00009607-P01)

Find related products by research area.

Blogs on CART/CARTPT

There are no specific blogs for CART/CARTPT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CART/CARTPT Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CARTPT
Entrez