Recombinant Human CARD14 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human CARD14 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 846-945 of Human CARD14

Source: Wheat Germ

Amino Acid Sequence: CLLQGFKKCLAEYLSQEEYEAWSQRGDIIQEGEVSGGRCWVTRHAVESLMEKNTHALLDVQLDSVCTLHRMDIFPIVIHVSVNEKMAKKLKKGLQRLGTS

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
CARD14
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CARD14 Protein

  • bcl10-interacting maguk protein 2
  • BIMP2
  • CARD-containing MAGUK protein 2
  • card-maguk protein 2
  • Carma 2
  • CARMA2CARD-containing MAGUK 2 protein
  • caspase recruitment domain family, member 14
  • caspase recruitment domain-containing protein 14

Background

CARD14 - caspase recruitment domain family, member 14

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67569
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-31928
Species: Hu
Applications: IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP2-30465
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NBP2-57614
Species: Hu
Applications: ICC/IF
NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90367
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-11228
Species: Hu
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56713
Species: Hu
Applications: WB, ICC/IF
H00079092-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for CARD14 Partial Recombinant Protein (H00079092-Q01) (0)

There are no publications for CARD14 Partial Recombinant Protein (H00079092-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CARD14 Partial Recombinant Protein (H00079092-Q01) (0)

There are no reviews for CARD14 Partial Recombinant Protein (H00079092-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CARD14 Partial Recombinant Protein (H00079092-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for CARD14 Partial Recombinant Protein (H00079092-Q01)

Discover related pathways, diseases and genes to CARD14 Partial Recombinant Protein (H00079092-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CARD14 Partial Recombinant Protein (H00079092-Q01)

Discover more about diseases related to CARD14 Partial Recombinant Protein (H00079092-Q01).
 

Pathways for CARD14 Partial Recombinant Protein (H00079092-Q01)

View related products by pathway.

PTMs for CARD14 Partial Recombinant Protein (H00079092-Q01)

Learn more about PTMs related to CARD14 Partial Recombinant Protein (H00079092-Q01).
 

Research Areas for CARD14 Partial Recombinant Protein (H00079092-Q01)

Find related products by research area.

Blogs on CARD14.

CARD14: The First Gene to be Linked to Psoriasis
Psoriasis is an autoimmune disease affects 3% of the United Kingdom's population and 7.5 million people in the United States are affected. This disease causes plaque formation on the skin due to an increased rate of skin cell growth. Psoriasis is trig...  Read full blog post.

Customers Who Bought This Also Bought

CARD14 Antibody
H00079092-B01P

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CARD14 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CARD14