Recombinant Human Carboxyl Ester Lipase/CEL Protein

Images

 

Order Details


    • Catalog Number
      H00001056-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Carboxyl Ester Lipase/CEL Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-100 of Human CEL partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:GLRGAKTTFDVYTESWAQDPSQENKKKTVVDFETDVLFLVPTEIALAQHRANAKSAKTYAYLFSHPSRMPVYPKWVGADHADDIQYVFGKPFATPTGYRP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CEL

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.
Publications
Read Publication using H00001056-Q01.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Carboxyl Ester Lipase/CEL Protein

  • BAL
  • bile salt-activated lipase
  • Bile salt-stimulated lipase
  • BSDL
  • BSSL
  • BSSLbile salt-dependent lipase, oncofetal isoform
  • bucelipase
  • carboxyl ester hydrolase
  • carboxyl ester lipase (bile salt-stimulated lipase)
  • Carboxyl Ester Lipase
  • CEase
  • CEL
  • CELL
  • Cholesterol esterase
  • EC 3.1.1
  • EC 3.1.1.13
  • EC 3.1.1.3
  • FAP
  • FAPP
  • fetoacinar pancreatic protein
  • LIPA
  • lysophospholipase, pancreatic
  • MODY8bile-salt-activated lipase
  • Pancreatic lysophospholipase
  • Sterol esterase

Background

CEL - carboxyl ester lipase (bile salt-stimulated lipase)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-37253
Species: Hu, Mu, Rt
Applications: WB
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89649
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85691
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB110-41536
Species: Hu, Mu
Applications: WB, ICC/IF
AF1180
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
NBP2-02948
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89285
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
H00001056-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Carboxyl Ester Lipase/CEL Partial Recombinant Protein (H00001056-Q01)(1)

Reviews for Carboxyl Ester Lipase/CEL Partial Recombinant Protein (H00001056-Q01) (0)

There are no reviews for Carboxyl Ester Lipase/CEL Partial Recombinant Protein (H00001056-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Carboxyl Ester Lipase/CEL Partial Recombinant Protein (H00001056-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Carboxyl Ester Lipase/CEL Products

Bioinformatics Tool for Carboxyl Ester Lipase/CEL Partial Recombinant Protein (H00001056-Q01)

Discover related pathways, diseases and genes to Carboxyl Ester Lipase/CEL Partial Recombinant Protein (H00001056-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Carboxyl Ester Lipase/CEL Partial Recombinant Protein (H00001056-Q01)

Discover more about diseases related to Carboxyl Ester Lipase/CEL Partial Recombinant Protein (H00001056-Q01).
 

Pathways for Carboxyl Ester Lipase/CEL Partial Recombinant Protein (H00001056-Q01)

View related products by pathway.

PTMs for Carboxyl Ester Lipase/CEL Partial Recombinant Protein (H00001056-Q01)

Learn more about PTMs related to Carboxyl Ester Lipase/CEL Partial Recombinant Protein (H00001056-Q01).

Blogs on Carboxyl Ester Lipase/CEL

There are no specific blogs for Carboxyl Ester Lipase/CEL, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Carboxyl Ester Lipase/CEL Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CEL
Entrez