Recombinant Human Carbonic Anhydrase VI Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Carbonic Anhydrase VI Peptides and Proteins

Order Details


    • Catalog Number
      H00000765-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Carbonic Anhydrase VI Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-100 of Human CA6 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LQHYYTYHGSLTTPPCTENVHWFVLADFVKLSRTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQEYTLGSEFQFYLHKIEEILDYLRRALN

Protein/Peptide Type
Partial Recombinant Protein
Gene
CA6

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Carbonic Anhydrase VI Protein

  • CA6
  • Carbonate dehydratase VI
  • carbonic anhydrase 6
  • Carbonic Anhydrase VI
  • carbonic anhydrase VIGUSTIN
  • CA-VI
  • EC 4.2.1.1
  • Gustin
  • MGC21256
  • Salivary carbonic anhydrase
  • Secreted carbonic anhydrase

Background

The protein encoded by this gene is one of several isozymes of carbonic anhydrase. This protein is found only in salivary glands and saliva and protein may play a role in the reversible hydratation of carbon dioxide though its function in saliva is unknown. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-919
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
MAB2186
Species: Hu
Applications: WB, IHC, IP
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
AF2180
Species: Hu
Applications: WB, Simple Western, IP
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-37493
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
AF1936
Species: Hu
Applications: WB, IP
AF4274
Species: Mu
Applications: WB, IHC
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
3177-CA
Species: Hu
NBP2-33404
Species: Hu
Applications: IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP1-83396
Species: Hu
Applications: IHC, IHC-P
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NBP1-62322
Species: Hu
Applications: WB
AF3865
Species: Hu
Applications: WB, IHC
MAB25031
Species: Hu
Applications: WB, IHC, IP
H00000765-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Carbonic Anhydrase VI Partial Recombinant Protein (H00000765-Q01) (0)

There are no publications for Carbonic Anhydrase VI Partial Recombinant Protein (H00000765-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Carbonic Anhydrase VI Partial Recombinant Protein (H00000765-Q01) (0)

There are no reviews for Carbonic Anhydrase VI Partial Recombinant Protein (H00000765-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Carbonic Anhydrase VI Partial Recombinant Protein (H00000765-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Carbonic Anhydrase VI Products

Bioinformatics Tool for Carbonic Anhydrase VI Partial Recombinant Protein (H00000765-Q01)

Discover related pathways, diseases and genes to Carbonic Anhydrase VI Partial Recombinant Protein (H00000765-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Carbonic Anhydrase VI Partial Recombinant Protein (H00000765-Q01)

Discover more about diseases related to Carbonic Anhydrase VI Partial Recombinant Protein (H00000765-Q01).
 

Pathways for Carbonic Anhydrase VI Partial Recombinant Protein (H00000765-Q01)

View related products by pathway.

PTMs for Carbonic Anhydrase VI Partial Recombinant Protein (H00000765-Q01)

Learn more about PTMs related to Carbonic Anhydrase VI Partial Recombinant Protein (H00000765-Q01).
 

Research Areas for Carbonic Anhydrase VI Partial Recombinant Protein (H00000765-Q01)

Find related products by research area.

Blogs on Carbonic Anhydrase VI.

CHOP/GADD153 - A regulator and marker for ER-stress induced apoptosis
C/EBP homologous protein (CHOP) is a transcription factor that regulates apoptosis in response to cellular stress. CHOP also known as growth arrest and DNA damage 153 (GADD153) was first cloned because of its induction in response to genotoxic str...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Carbonic Anhydrase VI Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CA6
Entrez