Recombinant Human Carbonic Anhydrase VB/CA5B Protein

Images

 

Order Details


    • Catalog Number
      H00011238-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Carbonic Anhydrase VB/CA5B Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 32905 of Human CA5B partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:VVMNSLRVILQASPGKLLWRKFQIPRFMPARPCSLYTCTYKTRNRALHPLWESVDLVPGGDRQSPINIRWRDSVYDPGLKPLTISYDPA

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
CA5B

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Carbonic Anhydrase VB/CA5B Protein

  • CA5B
  • Carbonate dehydratase VB
  • carbonic anhydrase 5B, mitochondrial
  • Carbonic Anhydrase VB
  • carbonic anhydrase VB, mitochondrial
  • carbonic dehydratase
  • CAVB
  • CA-VB
  • EC 4.2.1.1
  • MGC39962

Background

CA5B - carbonic anhydrase VB, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-507
Species: Hu, Mu
Applications: WB, PEP-ELISA
MAB7185
Species: Hu
Applications: WB, Simple Western
NBP1-90155
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32731
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00023635-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
H00011138-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-88114
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-86654
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
NBP1-81807
Species: Hu
Applications: IHC, IHC-P
NBP1-54805
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB600-1468
Species: Hu
Applications: WB, IHC-P, S-ELISA
AF1857
Species: Mu
Applications: WB, Simple Western, IP
NBP1-86214
Species: Hu
Applications: WB, IHC, IHC-P
AF283
Species: Hu, Rt
Applications: WB, ICC
H00011238-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Carbonic Anhydrase VB/CA5B Partial Recombinant Protein (H00011238-Q01) (0)

There are no publications for Carbonic Anhydrase VB/CA5B Partial Recombinant Protein (H00011238-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Carbonic Anhydrase VB/CA5B Partial Recombinant Protein (H00011238-Q01) (0)

There are no reviews for Carbonic Anhydrase VB/CA5B Partial Recombinant Protein (H00011238-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Carbonic Anhydrase VB/CA5B Partial Recombinant Protein (H00011238-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Carbonic Anhydrase VB/CA5B Products

Bioinformatics Tool for Carbonic Anhydrase VB/CA5B Partial Recombinant Protein (H00011238-Q01)

Discover related pathways, diseases and genes to Carbonic Anhydrase VB/CA5B Partial Recombinant Protein (H00011238-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Carbonic Anhydrase VB/CA5B Partial Recombinant Protein (H00011238-Q01)

Discover more about diseases related to Carbonic Anhydrase VB/CA5B Partial Recombinant Protein (H00011238-Q01).
 

Pathways for Carbonic Anhydrase VB/CA5B Partial Recombinant Protein (H00011238-Q01)

View related products by pathway.

PTMs for Carbonic Anhydrase VB/CA5B Partial Recombinant Protein (H00011238-Q01)

Learn more about PTMs related to Carbonic Anhydrase VB/CA5B Partial Recombinant Protein (H00011238-Q01).
 

Research Areas for Carbonic Anhydrase VB/CA5B Partial Recombinant Protein (H00011238-Q01)

Find related products by research area.

Blogs on Carbonic Anhydrase VB/CA5B

There are no specific blogs for Carbonic Anhydrase VB/CA5B, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Carbonic Anhydrase VB/CA5B Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CA5B
Entrez