Recombinant Human Carbonic Anhydrase IV/CA4 Protein

Images

 

Order Details


    • Catalog Number
      H00000762-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Carbonic Anhydrase IV/CA4 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-294 of Human CA4 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:AESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGAPGRPLPWALPALLGPMLACLLAGFLR

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
CA4

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Carbonic Anhydrase IV/CA4 Protein

  • CA4
  • CAIV
  • CA-IV
  • Car4
  • Carbonate dehydratase IV
  • carbonic anhydrase 4
  • Carbonic Anhydrase IV
  • carbonic anhydrase IVRP17
  • carbonic dehydratase IV
  • EC 4.2.1.1
  • retinitis pigmentosa 17 (autosomal dominant)
  • RP17

Background

CA4( AAH57792, 19 a.a. - 313 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2180
Species: Hu
Applications: WB, Simple Western, IP
AF2185
Species: Hu, Mu, Rt
Applications: WB, IP
NB600-919
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP2-32020
Species: Hu
Applications: IHC, IHC-P
NBP1-89330
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59744
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP1-62539
Species: Hu
Applications: WB
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NB100-417
Species: Hu, Mu, Rt, Ca, Pl
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-21590
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00000762-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for Carbonic Anhydrase IV/CA4 Recombinant Protein (H00000762-P01) (0)

There are no publications for Carbonic Anhydrase IV/CA4 Recombinant Protein (H00000762-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Carbonic Anhydrase IV/CA4 Recombinant Protein (H00000762-P01) (0)

There are no reviews for Carbonic Anhydrase IV/CA4 Recombinant Protein (H00000762-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Carbonic Anhydrase IV/CA4 Recombinant Protein (H00000762-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Carbonic Anhydrase IV/CA4 Products

Bioinformatics Tool for Carbonic Anhydrase IV/CA4 Recombinant Protein (H00000762-P01)

Discover related pathways, diseases and genes to Carbonic Anhydrase IV/CA4 Recombinant Protein (H00000762-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Carbonic Anhydrase IV/CA4 Recombinant Protein (H00000762-P01)

Discover more about diseases related to Carbonic Anhydrase IV/CA4 Recombinant Protein (H00000762-P01).
 

Pathways for Carbonic Anhydrase IV/CA4 Recombinant Protein (H00000762-P01)

View related products by pathway.

PTMs for Carbonic Anhydrase IV/CA4 Recombinant Protein (H00000762-P01)

Learn more about PTMs related to Carbonic Anhydrase IV/CA4 Recombinant Protein (H00000762-P01).
 

Research Areas for Carbonic Anhydrase IV/CA4 Recombinant Protein (H00000762-P01)

Find related products by research area.

Blogs on Carbonic Anhydrase IV/CA4

There are no specific blogs for Carbonic Anhydrase IV/CA4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Carbonic Anhydrase IV/CA4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CA4
Entrez