Carbonic Anhydrase IV/CA4 Antibody


Western Blot: Carbonic Anhydrase IV/CA4 Antibody [NBP1-69435] - This Anti-CA4 antibody was used in Western Blot of fetal lung tissue lysate at a concentration of 1ug/ml.
Immunohistochemistry: Carbonic Anhydrase IV/CA4 Antibody [NBP1-69435] - Human Lung Tissue Observed Staining: Cytoplasm and membrane of alveolar macrophages Primary Antibody Concentration: 1 : 600 Secondary Antibody: more

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC

Order Details

Carbonic Anhydrase IV/CA4 Antibody Summary

Synthetic peptides corresponding to CA4(carbonic anhydrase IV) The peptide sequence was selected from the C terminal of Carbonic Anhydrase IV. Peptide sequence AFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGAPGRPLPWALPALLG.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against CA4 and was validated on Western blot.
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Carbonic Anhydrase IV/CA4 Antibody

  • CA4
  • CAIV
  • CA-IV
  • Car4
  • Carbonate dehydratase IV
  • carbonic anhydrase 4
  • Carbonic Anhydrase IV
  • carbonic anhydrase IVRP17
  • carbonic dehydratase IV
  • EC
  • retinitis pigmentosa 17 (autosomal dominant)
  • RP17


Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA4 is a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the luminal surfaces of pulmonary (and certain other) capillaries and of proximal renal tubules. Its exact function is not known, however, it may have a role in inherited renal abnormalities of bicarbonate transport.Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA IV is a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the luminal surfaces of pulmonary (and certain other) capillaries and of proximal renal tubules. Its exact function is not known, however, it may have a role in inherited renal abnormalities of bicarbonate transport.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Simple Western, IP
Species: Hu, Mu, Rt
Applications: WB, IP
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
Species: Hu, Mu, Rt, Ca, Eq
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
Species: Hu, Mu, Rt, Ca, Pl
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC

Publications for Carbonic Anhydrase IV/CA4 Antibody (NBP1-69435) (0)

There are no publications for Carbonic Anhydrase IV/CA4 Antibody (NBP1-69435).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Carbonic Anhydrase IV/CA4 Antibody (NBP1-69435) (0)

There are no reviews for Carbonic Anhydrase IV/CA4 Antibody (NBP1-69435). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Carbonic Anhydrase IV/CA4 Antibody (NBP1-69435) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Carbonic Anhydrase IV/CA4 Products

Bioinformatics Tool for Carbonic Anhydrase IV/CA4 Antibody (NBP1-69435)

Discover related pathways, diseases and genes to Carbonic Anhydrase IV/CA4 Antibody (NBP1-69435). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Carbonic Anhydrase IV/CA4 Antibody (NBP1-69435)

Discover more about diseases related to Carbonic Anhydrase IV/CA4 Antibody (NBP1-69435).

Pathways for Carbonic Anhydrase IV/CA4 Antibody (NBP1-69435)

View related products by pathway.

PTMs for Carbonic Anhydrase IV/CA4 Antibody (NBP1-69435)

Learn more about PTMs related to Carbonic Anhydrase IV/CA4 Antibody (NBP1-69435).

Research Areas for Carbonic Anhydrase IV/CA4 Antibody (NBP1-69435)

Find related products by research area.

Blogs on Carbonic Anhydrase IV/CA4

There are no specific blogs for Carbonic Anhydrase IV/CA4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Carbonic Anhydrase IV/CA4 Antibody and receive a gift card or discount.


Gene Symbol CA4