Carbonic Anhydrase II/CA2 Antibody


Western Blot: Carbonic Anhydrase II Antibody [NBP1-68891] - Human Liver cell lysate, concentration 0.2-1 ug/ml.

Product Details

Product Discontinued
View other related Carbonic Anhydrase II/CA2 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Carbonic Anhydrase II/CA2 Antibody Summary

Synthetic peptides corresponding to CA2 (carbonic anhydrase II) The peptide sequence was selected from the C terminal of CA2. Peptide sequence FGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFD.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CA2 and was validated on Western blot.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Carbonic Anhydrase II/CA2 Antibody

  • CA2
  • CAII
  • Car2
  • Carbonate dehydratase II
  • carbonic anhydrase 2
  • carbonic anhydrase B
  • Carbonic anhydrase C
  • Carbonic Anhydrase II
  • carbonic anhydrase IICAC
  • carbonic dehydratase


CA2 is essential for bone resorption and osteoclast differentiation. CA2 is implicated in reversible hydration of carbon dioxide. CA2 can hydrates cyanamide to urea. CA2 is involved in the regulation of fluid secretion into the anterior chamber of the eye.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Ca, Eq
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
Species: Hu
Applications: WB

Publications for Carbonic Anhydrase II/CA2 Antibody (NBP1-68891) (0)

There are no publications for Carbonic Anhydrase II/CA2 Antibody (NBP1-68891).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Carbonic Anhydrase II/CA2 Antibody (NBP1-68891) (0)

There are no reviews for Carbonic Anhydrase II/CA2 Antibody (NBP1-68891). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Carbonic Anhydrase II/CA2 Antibody (NBP1-68891) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Carbonic Anhydrase II/CA2 Products

Bioinformatics Tool for Carbonic Anhydrase II/CA2 Antibody (NBP1-68891)

Discover related pathways, diseases and genes to Carbonic Anhydrase II/CA2 Antibody (NBP1-68891). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Carbonic Anhydrase II/CA2 Antibody (NBP1-68891)

Discover more about diseases related to Carbonic Anhydrase II/CA2 Antibody (NBP1-68891).

Pathways for Carbonic Anhydrase II/CA2 Antibody (NBP1-68891)

View related products by pathway.

PTMs for Carbonic Anhydrase II/CA2 Antibody (NBP1-68891)

Learn more about PTMs related to Carbonic Anhydrase II/CA2 Antibody (NBP1-68891).

Research Areas for Carbonic Anhydrase II/CA2 Antibody (NBP1-68891)

Find related products by research area.

Blogs on Carbonic Anhydrase II/CA2

There are no specific blogs for Carbonic Anhydrase II/CA2, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Carbonic Anhydrase II/CA2 Antibody and receive a gift card or discount.


Gene Symbol CA2