Carbohydrate Sulfotransferase 3/CHST3 Antibody (1C4) Summary
Immunogen |
CHST3 (NP_004264, 312 a.a. ~ 411 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VAFAGKYKTWKKWLDDEGQDGLREEEVQRLRGNCESIRLSAELGLRQPAWLRGRYMLVRYEDVARGPLQKAREMYRFAGIPLTPQVEDWIQKNTQAAHDG |
Specificity |
CHST3 - carbohydrate (chondroitin 6) sulfotransferase 3 |
Isotype |
IgG2a Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
CHST3 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Sandwich ELISA
- Western Blot 1:500
|
Application Notes |
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
Reactivity Notes
Human. Other species not tested.
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Carbohydrate Sulfotransferase 3/CHST3 Antibody (1C4)
Background
The Carbohydrate sulfotransferase 3 gene encodes an enzyme which catalyzes the sulfation of chondroitin, a proteoglycan found in the extracellular matrix and most cells which is involved in cell migration and differentiation. Mutations in this gene are associated with spondylepiphyseal
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, RM
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Pm, Bv, Gt, Hu, Mu, Po, Pm, Rt, Sh
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu, Mu
Applications: IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Publications for Carbohydrate Sulfotransferase 3/CHST3 Antibody (H00009469-M01) (0)
There are no publications for Carbohydrate Sulfotransferase 3/CHST3 Antibody (H00009469-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Carbohydrate Sulfotransferase 3/CHST3 Antibody (H00009469-M01) (0)
There are no reviews for Carbohydrate Sulfotransferase 3/CHST3 Antibody (H00009469-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Carbohydrate Sulfotransferase 3/CHST3 Antibody (H00009469-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Carbohydrate Sulfotransferase 3/CHST3 Products
Bioinformatics Tool for Carbohydrate Sulfotransferase 3/CHST3 Antibody (H00009469-M01)
Discover related pathways, diseases and genes to Carbohydrate Sulfotransferase 3/CHST3 Antibody (H00009469-M01). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Carbohydrate Sulfotransferase 3/CHST3 Antibody (H00009469-M01)
Discover more about diseases related to Carbohydrate Sulfotransferase 3/CHST3 Antibody (H00009469-M01).
| | Pathways for Carbohydrate Sulfotransferase 3/CHST3 Antibody (H00009469-M01)
View related products by pathway.
|
Research Areas for Carbohydrate Sulfotransferase 3/CHST3 Antibody (H00009469-M01)
Find related products by research area.
|
Blogs on Carbohydrate Sulfotransferase 3/CHST3