Recombinant Human CAR/NR1I3 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human CAR/NR1I3 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 2-59 of Human CAR/NR1I3

Source: Wheat Germ

Amino Acid Sequence: ASREDELRNCVVCGDQATGYHFNALTCEGCKGFFRRTVSKSIGPTCPFAGSCEVSKTQ

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
NR1I3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
32.12 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CAR/NR1I3 Protein

  • CAR
  • CARCAR1
  • Constitutive activator of retinoid response
  • constitutive active receptor
  • Constitutive active response
  • Constitutive androstane receptor
  • MB67
  • MGC150433
  • MGC97144
  • MGC97209
  • NR1I3
  • nuclear receptor subfamily 1 group I member 3
  • nuclear receptor subfamily 1, group I, member 3
  • orphan nuclear hormone receptor
  • Orphan nuclear receptor MB67

Background

This gene encodes a member of the nuclear receptor superfamily, and is a key regulator of xenobiotic and endobiotic metabolism. The protein binds to DNA as a monomer or a heterodimer with the retinoid X receptor and regulates the transcription of target genes involved in drug metabolism and bilirubin clearance, such as cytochrome P450 family members. Unlike most nuclear receptors, this transcriptional regulator is constitutively active in the absence of ligand but is regulated by both agonists and inverse agonists. Ligand binding results in translocation of this protein to the nucleus, where it activates or represses target gene transcription. These ligands include bilirubin, a variety of foreign compounds, steroid hormones, and prescription drugs. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-61816
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-01800
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF7356
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB400-153
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-88192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1106
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, B/N
NBP2-66958
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF6490
Species: Hu
Applications: WB, IHC, ICC
NB100-80870
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ELISA, IHC, IHC-P
NBP1-89679
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01397
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for CAR/NR1I3 Partial Recombinant Protein (H00009970-Q01) (0)

There are no publications for CAR/NR1I3 Partial Recombinant Protein (H00009970-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CAR/NR1I3 Partial Recombinant Protein (H00009970-Q01) (0)

There are no reviews for CAR/NR1I3 Partial Recombinant Protein (H00009970-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CAR/NR1I3 Partial Recombinant Protein (H00009970-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for CAR/NR1I3 Partial Recombinant Protein (H00009970-Q01)

Discover related pathways, diseases and genes to CAR/NR1I3 Partial Recombinant Protein (H00009970-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CAR/NR1I3 Partial Recombinant Protein (H00009970-Q01)

Discover more about diseases related to CAR/NR1I3 Partial Recombinant Protein (H00009970-Q01).
 

Pathways for CAR/NR1I3 Partial Recombinant Protein (H00009970-Q01)

View related products by pathway.

PTMs for CAR/NR1I3 Partial Recombinant Protein (H00009970-Q01)

Learn more about PTMs related to CAR/NR1I3 Partial Recombinant Protein (H00009970-Q01).
 

Research Areas for CAR/NR1I3 Partial Recombinant Protein (H00009970-Q01)

Find related products by research area.

Blogs on CAR/NR1I3

There are no specific blogs for CAR/NR1I3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CAR/NR1I3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NR1I3
Entrez