CAMLG Antibody


Western Blot: CAMLG Antibody [NBP2-33661] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: CAMLG Antibody [NBP2-33661] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus, nucleoli & vesicles.
Immunohistochemistry-Paraffin: CAMLG Antibody [NBP2-33661] - Staining of human cerebellum shows cytoplasmic and nuclear positivity in Purkinje cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

CAMLG Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: GDKLDSFIKPPECSSDVNLELRQRNRGDLTADSVQRGSRHGLEQYLSRFEEAMKLRKQLISEKPSQEDGNTTEE
Specificity of human CAMLG antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CAMLG Protein (NBP2-33661PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (88%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CAMLG Antibody

  • calcium modulating ligand
  • calcium signal-modulating cyclophilin ligand
  • calcium-signal modulating cyclophilin ligand
  • CAMLcalcium-modulating cyclophilin ligand
  • cyclophilin B-binding protein
  • MGC163197


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, B/N, IHC-FrFl
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Pm
Applications: WB, ELISA, Flow, Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
Species: Hu
Species: Mu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt, Po, Bv, Eq, Ha, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, RNAi, S-ELISA
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu

Publications for CAMLG Antibody (NBP2-33661) (0)

There are no publications for CAMLG Antibody (NBP2-33661).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CAMLG Antibody (NBP2-33661) (0)

There are no reviews for CAMLG Antibody (NBP2-33661). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CAMLG Antibody (NBP2-33661) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional CAMLG Products

Bioinformatics Tool for CAMLG Antibody (NBP2-33661)

Discover related pathways, diseases and genes to CAMLG Antibody (NBP2-33661). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CAMLG Antibody (NBP2-33661)

Discover more about diseases related to CAMLG Antibody (NBP2-33661).

Pathways for CAMLG Antibody (NBP2-33661)

View related products by pathway.

PTMs for CAMLG Antibody (NBP2-33661)

Learn more about PTMs related to CAMLG Antibody (NBP2-33661).

Blogs on CAMLG

There are no specific blogs for CAMLG, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CAMLG Antibody and receive a gift card or discount.


Gene Symbol CAMLG