CaMKII beta Antibody


Western Blot: CaMKII beta Antibody [NBP1-74131] - Human Fetal Heart Lysate, Antibody Titration: 1 ug/ml, and Gel concentration: 12%

Product Details

Product Discontinued
View other related CaMKII beta Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

CaMKII beta Antibody Summary

Synthetic peptides corresponding to the C terminal of CAMK2B. Immunizing peptide sequence NPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWQNV.
This product is specific to Subunit or Isoform: beta.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CAMK2B and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CaMKII beta Antibody

  • calcium/calmodulin-dependent protein kinase (CaM kinase) II beta
  • calcium/calmodulin-dependent protein kinase II beta
  • calcium/calmodulin-dependent protein kinase type II beta chain
  • calcium/calmodulin-dependent protein kinase type II subunit beta
  • CaM kinase II beta subunit
  • CaM kinase II subunit beta
  • CaMK-II subunit beta
  • CaM-kinase II beta chain
  • EC 2.7.11
  • EC
  • MGC29528
  • proline rich calmodulin-dependent protein kinase


The product of this gene belongs to the serine/threonine protein kinase family and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. In mammalian cells, the enzyme is composed of four different chains: alpha, beta, gamma, and delta. The product of this gene is a beta chain. It is possible that distinct isoforms of this chain have different cellular localizations and interact differently with calmodulin. Eight transcript variants encoding eight distinct isoforms have been identified for this gene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
Species: Hu
Species: Hu
Applications: WB, Flow, IHC-P, IP, Flow-CS
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Eq
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu, Mu
Applications: WB, Simple Western, IP
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for CaMKII beta Antibody (NBP1-74131) (0)

There are no publications for CaMKII beta Antibody (NBP1-74131).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CaMKII beta Antibody (NBP1-74131) (0)

There are no reviews for CaMKII beta Antibody (NBP1-74131). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CaMKII beta Antibody (NBP1-74131) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CaMKII beta Products

Bioinformatics Tool for CaMKII beta Antibody (NBP1-74131)

Discover related pathways, diseases and genes to CaMKII beta Antibody (NBP1-74131). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CaMKII beta Antibody (NBP1-74131)

Discover more about diseases related to CaMKII beta Antibody (NBP1-74131).

Pathways for CaMKII beta Antibody (NBP1-74131)

View related products by pathway.

PTMs for CaMKII beta Antibody (NBP1-74131)

Learn more about PTMs related to CaMKII beta Antibody (NBP1-74131).

Research Areas for CaMKII beta Antibody (NBP1-74131)

Find related products by research area.

Blogs on CaMKII beta

There are no specific blogs for CaMKII beta, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CaMKII beta Antibody and receive a gift card or discount.


Gene Symbol CAMK2B