Calponin 1 Antibody


Western Blot: Calponin Antibody [NBP1-56572] - Murine uteria tissue, concentration 0.5 ug/ml.
Western Blot: Calponin Antibody [NBP1-56572] - Hela cell lysate, concentration 0.2-1 ug/ml.

Product Details

Product Discontinued
View other related Calponin 1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Calponin 1 Antibody Summary

Synthetic peptides corresponding to CNN1(calponin 1, basic, smooth muscle) The peptide sequence was selected from the N terminal of CNN1. Peptide sequence MSSAHFNRGPAYGLSAEVKNKLAQKYDHQREQELREWIEGVTGRRIGNNF.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CNN1 and was validated on Western blot.
Positive Control
Calponin 1 Lysate (NBP2-66304)

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Calponin 1 Antibody

  • Basic calponin
  • Calponin 1
  • calponin 1, basic, smooth muscle
  • Calponin H1
  • Calponin H1, smooth muscle
  • calponins, basic
  • CNN1
  • Sm-Calp
  • SMCC
  • SMCCcalponin-1


CNN1 is a thin filament-associated protein that is implicated in the regulation and modulation of smooth muscle contraction. It is capable of binding to actin, calmodulin, troponin C and tropomyosin. The interaction of calponin with actin inhibits the actomyosin Mg-ATPase activity.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, PAGE, IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA
Species: Hu, Mu, Rt, Rb
Applications: WB, PEP-ELISA
Species: Hu
Applications: ICC/IF
Species: Hu
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
Species: Hu
Applications: WB
Species: Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-Fr, IHC-P, IP
Species: Hu, Mu(-)
Applications: WB (-), ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB

Publications for Calponin 1 Antibody (NBP1-56572) (0)

There are no publications for Calponin 1 Antibody (NBP1-56572).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Calponin 1 Antibody (NBP1-56572) (0)

There are no reviews for Calponin 1 Antibody (NBP1-56572). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Calponin 1 Antibody (NBP1-56572) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Calponin 1 Products

Bioinformatics Tool for Calponin 1 Antibody (NBP1-56572)

Discover related pathways, diseases and genes to Calponin 1 Antibody (NBP1-56572). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Calponin 1 Antibody (NBP1-56572)

Discover more about diseases related to Calponin 1 Antibody (NBP1-56572).

Pathways for Calponin 1 Antibody (NBP1-56572)

View related products by pathway.

PTMs for Calponin 1 Antibody (NBP1-56572)

Learn more about PTMs related to Calponin 1 Antibody (NBP1-56572).

Research Areas for Calponin 1 Antibody (NBP1-56572)

Find related products by research area.

Blogs on Calponin 1

There are no specific blogs for Calponin 1, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Calponin 1 Antibody and receive a gift card or discount.


Gene Symbol CNN1