Recombinant Human Calpastatin Protein

Images

 
SDS-Page: Recombinant Human Calpastatin Protein [H00000831-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Calpastatin Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-88 of Human CAST partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:QPDPDENKPMEDKVKEKAKAEHRDKLGERDDTIPPEYRHLLDDNGQDKPVKPPTKKSEDSKKPADDQDPIDALSGDLDSCPSTTETSQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CAST

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Calpastatin Protein

  • BS-17
  • Calpain inhibitor
  • calpastatin
  • MGC9402
  • Sperm BS-17 component

Background

The protein encoded by this gene is an endogenous calpain (calcium-dependent cysteine protease) inhibitor. It consists of an N-terminal domain L and four repetitive calpain-inhibition domains (domains 1-4), and it is involved in the proteolysis of amyloid precursor protein. The calpain/calpastatin system is involved in numerous membrane fusion events, such as neural vesicle exocytosis and platelet and red-cell aggregation. The encoded protein is also thought to affect the expression levels of genes encoding structural or regulatory proteins. Several alternatively spliced transcript variants of this gene have been described, but the full-length natures of only some have been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15675
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB120-3588
Species: Hu, Mu, Rt, Po, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NB120-3588
Species: Hu, Mu, Rt, Po, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP2-15675
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-98474
Species: Hu
Applications: WB
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF

Publications for Calpastatin Partial Recombinant Protein (H00000831-Q01) (0)

There are no publications for Calpastatin Partial Recombinant Protein (H00000831-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Calpastatin Partial Recombinant Protein (H00000831-Q01) (0)

There are no reviews for Calpastatin Partial Recombinant Protein (H00000831-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Calpastatin Partial Recombinant Protein (H00000831-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Calpastatin Products

Bioinformatics Tool for Calpastatin Partial Recombinant Protein (H00000831-Q01)

Discover related pathways, diseases and genes to Calpastatin Partial Recombinant Protein (H00000831-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Calpastatin Partial Recombinant Protein (H00000831-Q01)

Discover more about diseases related to Calpastatin Partial Recombinant Protein (H00000831-Q01).
 

Pathways for Calpastatin Partial Recombinant Protein (H00000831-Q01)

View related products by pathway.

PTMs for Calpastatin Partial Recombinant Protein (H00000831-Q01)

Learn more about PTMs related to Calpastatin Partial Recombinant Protein (H00000831-Q01).
 

Research Areas for Calpastatin Partial Recombinant Protein (H00000831-Q01)

Find related products by research area.

Blogs on Calpastatin

There are no specific blogs for Calpastatin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Calpastatin Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CAST