Calpain small subunit 1 Antibody


Western Blot: Calpain small subunit 1 Antibody [NBP1-56556] - Human Fetal Lung lysate, concentration 0.2-1 ug/ml.

Product Details

Product Discontinued
View other related Calpain small subunit 1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Calpain small subunit 1 Antibody Summary

Synthetic peptides corresponding to CAPNS1 (calpain, small subunit 1) The peptide sequence was selected from the middle region of CAPNS1)(50ug). Peptide sequence RRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQL.
This product is specific to Subunit or Isoform: 1.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CAPNS1 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Calpain small subunit 1 Antibody

  • Calcium-activated neutral proteinase small subunit
  • Calcium-dependent protease small subunit 1
  • Calcium-dependent protease small subunit
  • calcium-dependent protease, small subunit
  • calpain 4, small subunit (30K)
  • Calpain regulatory subunit
  • calpain small subunit 1
  • calpain, small polypeptide
  • calpain, small subunit 1
  • CANP
  • CDPSCANP small subunit
  • CSS1


Calpains are a ubiquitous, well-conserved family of calcium-dependent, cysteine proteases. Calpain families have been implicated in neurodegenerative processes, as their activation can be triggered by calcium influx and oxidative stress. Calpain I and II are heterodimeric with distinct large subunits associated with common small subunits, all of which are encoded by different genes. This gene encodes a small subunit common to both calpain I and II and is associated with myotonic dystrophy. Two transcript variants encoding the same protein have been identified for this gene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu, Mu, Rt, Po, Bv, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, ICC, KO
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF

Publications for Calpain small subunit 1 Antibody (NBP1-56556) (0)

There are no publications for Calpain small subunit 1 Antibody (NBP1-56556).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Calpain small subunit 1 Antibody (NBP1-56556) (0)

There are no reviews for Calpain small subunit 1 Antibody (NBP1-56556). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Calpain small subunit 1 Antibody (NBP1-56556) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Calpain small subunit 1 Products

Bioinformatics Tool for Calpain small subunit 1 Antibody (NBP1-56556)

Discover related pathways, diseases and genes to Calpain small subunit 1 Antibody (NBP1-56556). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Calpain small subunit 1 Antibody (NBP1-56556)

Discover more about diseases related to Calpain small subunit 1 Antibody (NBP1-56556).

Pathways for Calpain small subunit 1 Antibody (NBP1-56556)

View related products by pathway.

PTMs for Calpain small subunit 1 Antibody (NBP1-56556)

Learn more about PTMs related to Calpain small subunit 1 Antibody (NBP1-56556).

Blogs on Calpain small subunit 1

There are no specific blogs for Calpain small subunit 1, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Calpain small subunit 1 Antibody and receive a gift card or discount.


Gene Symbol CAPNS1