Calpain small subunit 1 Antibody (3C4) [DyLight 405LS]

Images

 

Product Details

Summary
Product Discontinued
View other related Calpain small subunit 1 Primary Antibodies

Order Details


    • Catalog Number
      H00000826-M01V3
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Calpain small subunit 1 Antibody (3C4) [DyLight 405LS] Summary

Immunogen
CAPNS1 (AAH00592 172 a.a. - 260 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KRWQAIYKQFDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQE
Specificity
CAPNS1 - calpain, small subunit 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CAPNS1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Calpain small subunit 1 Antibody (3C4) [DyLight 405LS]

  • Calcium-activated neutral proteinase small subunit
  • Calcium-dependent protease small subunit 1
  • Calcium-dependent protease small subunit
  • calcium-dependent protease, small subunit
  • calpain 4, small subunit (30K)
  • Calpain regulatory subunit
  • calpain small subunit 1
  • calpain, small polypeptide
  • calpain, small subunit 1
  • CANP
  • CANPS
  • CAPN4CALPAIN4,30K
  • CAPNS
  • CDPSCANP small subunit
  • CSS1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15675
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB120-3588
Species: Hu, Mu, Rt, Po, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
NB120-3515
Species: Hu, Rt, Po, Bv, Ca, Fi, Rb
Applications: WB, IHC, IHC-Fr, IHC-P, ICC
NBP2-19586
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP2-13980
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00000825-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-79818
Species: Hu
Applications: WB
NBP1-88087
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-98474
Species: Hu
Applications: WB
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NB120-3588
Species: Hu, Mu, Rt, Po, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
AF1555
Species: Hu
Applications: WB
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NB110-58748
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF

Publications for Calpain small subunit 1 Antibody (H00000826-M01V3) (0)

There are no publications for Calpain small subunit 1 Antibody (H00000826-M01V3).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Calpain small subunit 1 Antibody (H00000826-M01V3) (0)

There are no reviews for Calpain small subunit 1 Antibody (H00000826-M01V3). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Calpain small subunit 1 Antibody (H00000826-M01V3) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Calpain small subunit 1 Products

Bioinformatics Tool for Calpain small subunit 1 Antibody (H00000826-M01V3)

Discover related pathways, diseases and genes to Calpain small subunit 1 Antibody (H00000826-M01V3). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Calpain small subunit 1 Antibody (H00000826-M01V3)

Discover more about diseases related to Calpain small subunit 1 Antibody (H00000826-M01V3).
 

Pathways for Calpain small subunit 1 Antibody (H00000826-M01V3)

View related products by pathway.

PTMs for Calpain small subunit 1 Antibody (H00000826-M01V3)

Learn more about PTMs related to Calpain small subunit 1 Antibody (H00000826-M01V3).
 

Research Areas for Calpain small subunit 1 Antibody (H00000826-M01V3)

Find related products by research area.

Blogs on Calpain small subunit 1

There are no specific blogs for Calpain small subunit 1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Calpain small subunit 1 Antibody (3C4) [DyLight 405LS] and receive a gift card or discount.

Bioinformatics

Gene Symbol CAPNS1