Novus Biologicals products are now on bio-techne.com

Calpain S2 Antibody - Azide and BSA Free

Images

 
Western Blot: Calpain S2 Antibody [NBP3-03218] - Analysis of extracts of mouse brain, using Calpain S2 antibody at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. ...read more

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
Azide and BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

Calpain S2 Antibody - Azide and BSA Free Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Calpain S2 (NP_115706.1). MFLAKALLEGADRGLGEALGGLFGGGGQRREGGGRNIGGIVGGIVNFISEAAAAQYTPEPPPTQQHFTSVEASESEEVRRFRQQFTQLAGPDMEVGATDL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CAPNS2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:200-1:500
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS with 50% glycerol, pH7.3.
Preservative
0.01% Thimerosal
Purity
Affinity purified

Alternate Names for Calpain S2 Antibody - Azide and BSA Free

  • Calcium-dependent protease small subunit 2
  • calpain small subunit 2
  • calpain, small subunit 2
  • CSS2
  • MGC12536
  • MGC14804

Background

Calcium-regulated non-lysosomal thiol-protease which catalyzes limited proteolysis of substrates involved incytoskeletal remodeling and signal transduction. This small subunit may act as a tissue-specific chaperone of thelarge subunit, possibly by helping it fold into its correct conformation for activity

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00022856-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
H00000826-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, PLA, S-ELISA, WB
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88204
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88087
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
DTM100
Species: Hu
Applications: ELISA
NBP2-01446
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-76513
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-88925
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31413
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NB300-653
Species: Ch, Fe, Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP3-03218
Species: Mu
Applications: WB

Publications for Calpain S2 Antibody (NBP3-03218) (0)

There are no publications for Calpain S2 Antibody (NBP3-03218).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Calpain S2 Antibody (NBP3-03218) (0)

There are no reviews for Calpain S2 Antibody (NBP3-03218). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Calpain S2 Antibody (NBP3-03218) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Calpain S2 Products

Research Areas for Calpain S2 Antibody (NBP3-03218)

Find related products by research area.

Blogs on Calpain S2

There are no specific blogs for Calpain S2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Calpain S2 Antibody - Azide and BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol CAPNS2