Recombinant Human Calpain 7 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Calpain 7 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 714-813 of Human CAPN7 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:NPIYQFHIEKTGPLLIELRGPRQYSVGFEVVTVSTLGDPGPHGFLRKSSGDYRCGFCYLELENIPSGIFNIIPSTFLPKQEGPFFLDFNSIIPIKITQLQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CAPN7
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Calpain 7 Protein

  • calpain 7
  • calpain like protease
  • CALPAIN7
  • EC 3.4.22
  • EC 3.4.22.-
  • FLJ36423
  • homolog of Aspergillus Nidulans PALB
  • PalB homolog
  • PalBH
  • PALBHcalpain-7

Background

Calpains are ubiquitous, well-conserved family of calcium-dependent, cysteine proteases. The calpain proteins are heterodimers consisting of an invariant small subunit and variable large subunits. The large subunit possesses a cysteine protease domain, and both subunits possess calcium-binding domains. Calpains have been implicated in neurodegenerative processes, as their activation can be triggered by calcium influx and oxidative stress. The function of the protein encoded by this gene is not known. An orthologue has been found in mouse but it seems to diverge from other family members. The mouse orthologue is thought to be calcium independent with protease activity. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20881
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37986
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP2-33720
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57242
Species: Hu
Applications: WB, ICC/IF
NBP1-87489
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP2-24716
Species: Hu, Pm
Applications: WB, IHC-P
NBP2-37881
Species: Hu
Applications: IHC, IHC-P
H00006532-M06
Species: Hu
Applications: ELISA, IP
H00000726-P01
Species: Hu
H00023473-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Calpain 7 Partial Recombinant Protein (H00023473-Q01) (0)

There are no publications for Calpain 7 Partial Recombinant Protein (H00023473-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Calpain 7 Partial Recombinant Protein (H00023473-Q01) (0)

There are no reviews for Calpain 7 Partial Recombinant Protein (H00023473-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Calpain 7 Partial Recombinant Protein (H00023473-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Calpain 7 Products

Bioinformatics Tool for Calpain 7 Partial Recombinant Protein (H00023473-Q01)

Discover related pathways, diseases and genes to Calpain 7 Partial Recombinant Protein (H00023473-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Calpain 7 Partial Recombinant Protein (H00023473-Q01)

Discover more about diseases related to Calpain 7 Partial Recombinant Protein (H00023473-Q01).
 

Pathways for Calpain 7 Partial Recombinant Protein (H00023473-Q01)

View related products by pathway.

PTMs for Calpain 7 Partial Recombinant Protein (H00023473-Q01)

Learn more about PTMs related to Calpain 7 Partial Recombinant Protein (H00023473-Q01).

Blogs on Calpain 7

There are no specific blogs for Calpain 7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MTSS1 Antibody
NBP2-24716

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Calpain 7 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CAPN7