Calpain 15 Antibody (9E220)

Images

 
Immunocytochemistry/ Immunofluorescence: Calpain 15 Antibody (4E2) [H00006650-M05] - Analysis of monoclonal antibody to SOLH on HeLa cell. Antibody concentration 10 ug/ml
Sandwich ELISA: Calpain 15 Antibody (4E2) [H00006650-M05] - Detection limit for recombinant GST tagged SOLH is 3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, ICC/IF
Clone
9E220
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Calpain 15 Antibody (9E220) Summary

Immunogen
SOLH (NP_005623 993 a.a. - 1086 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HPKAYLHVQCDCTDSFNVVSTRGSLRTQDSVPPLHRQVLVILSQLEGNAGFSITHRLAHRKAAQAFLSDWTASKGTHSPPLTPEVAGLHGPRPL
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SOLH
Purity
Ascites
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Ascites

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Calpain 15 Antibody (9E220)

  • calpain-15
  • CAPN15Small optic lobes homolog
  • EC 3.4.22
  • EC 3.4.22.-
  • EC 3.4.22.54
  • MGC131491
  • small optic lobes (Drosophila) homolog
  • small optic lobes homolog (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81628
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-77305
Species: Hu
Applications: WB, ELISA, ICC/IF, IF
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
AF5077
Species: Hu
Applications: WB
NBP1-84378
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86517
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5315
Species: Hu, Mu
Applications: WB
NB300-622
Species: Hu, Mu, Rt, Am, Ca, Rb
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
45750002
Species: Hu
Applications: WB, ELISA
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
H00006650-M05
Species: Hu
Applications: ELISA, ICC/IF

Publications for Calpain 15 (H00006650-M05) (0)

There are no publications for Calpain 15 (H00006650-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Calpain 15 (H00006650-M05) (0)

There are no reviews for Calpain 15 (H00006650-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Calpain 15 (H00006650-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Calpain 15 (H00006650-M05)

Discover related pathways, diseases and genes to Calpain 15 (H00006650-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Calpain 15 (H00006650-M05)

Discover more about diseases related to Calpain 15 (H00006650-M05).
 

Pathways for Calpain 15 (H00006650-M05)

View related products by pathway.

PTMs for Calpain 15 (H00006650-M05)

Learn more about PTMs related to Calpain 15 (H00006650-M05).
 

Research Areas for Calpain 15 (H00006650-M05)

Find related products by research area.

Blogs on Calpain 15

There are no specific blogs for Calpain 15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Calpain 15 Antibody (9E220) and receive a gift card or discount.

Bioinformatics

Gene Symbol SOLH