Calmodulin 2 Antibody (3F4-G5) [Alexa Fluor® 700]

Images

 

Product Details

Summary
Product Discontinued
View other related Calmodulin 2 Primary Antibodies

Order Details


    • Catalog Number
      H00000805-M01AF700
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Calmodulin 2 Antibody (3F4-G5) [Alexa Fluor® 700] Summary

Immunogen
CALM2 (AAH03354, 1 a.a. - 149 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKVKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK
Specificity
CALM2 - calmodulin 2 (phosphorylase kinase, delta)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CALM2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. This product is produced by and distributed for Abnova, a company based in Taiwan.This product is provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com.

Alternate Names for Calmodulin 2 Antibody (3F4-G5) [Alexa Fluor® 700]

  • CALM
  • CALM1
  • CALM3
  • CALML2
  • calmodulin 2 (phosphorylase kinase, delta)
  • calmodulin
  • CAM
  • CAM1
  • CAM2
  • CAM3
  • CAMB
  • CAMC
  • CAMII
  • CAMIII
  • FLJ99410
  • LP7057 protein
  • PHKD
  • PHKD2
  • phosphorylase kinase delta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NBP1-87744
Species: Hu
Applications: WB, IHC, IHC-P
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF7947
Species: Hu, Mu, Rt
Applications: WB, IHC
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-46183
Species: Hu
Applications: WB, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-86648
Species: Hu
Applications: WB, IHC, IHC-P
H00085366-M01
Species: Hu
Applications: WB, ELISA, RNAi
NBP1-85702
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00000805-M01AF700
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for Calmodulin 2 Antibody (H00000805-M01AF700) (0)

There are no publications for Calmodulin 2 Antibody (H00000805-M01AF700).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Calmodulin 2 Antibody (H00000805-M01AF700) (0)

There are no reviews for Calmodulin 2 Antibody (H00000805-M01AF700). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Calmodulin 2 Antibody (H00000805-M01AF700) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Calmodulin 2 Products

Bioinformatics Tool for Calmodulin 2 Antibody (H00000805-M01AF700)

Discover related pathways, diseases and genes to Calmodulin 2 Antibody (H00000805-M01AF700). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Calmodulin 2 Antibody (H00000805-M01AF700)

Discover more about diseases related to Calmodulin 2 Antibody (H00000805-M01AF700).
 

Pathways for Calmodulin 2 Antibody (H00000805-M01AF700)

View related products by pathway.

PTMs for Calmodulin 2 Antibody (H00000805-M01AF700)

Learn more about PTMs related to Calmodulin 2 Antibody (H00000805-M01AF700).
 

Research Areas for Calmodulin 2 Antibody (H00000805-M01AF700)

Find related products by research area.

Blogs on Calmodulin 2

There are no specific blogs for Calmodulin 2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Calmodulin 2 Antibody (3F4-G5) [Alexa Fluor® 700] and receive a gift card or discount.

Bioinformatics

Gene Symbol CALM2