Caldesmon/CALD1 Antibody

Images

 
Western Blot: Caldesmon/CALD1 Antibody [H00000800-B01P] - Analysis of CALD1 expression in transfected 293T cell line by CALD1 polyclonal antibody. Lane 1: CALD1 transfected lysate(59.18 KDa). Lane 2: Non-transfected ...read more
Immunohistochemistry-Paraffin: Caldesmon/CALD1 Antibody [H00000800-B01P] - Analysis of purified antibody to CALD1 on formalin-fixed paraffin-embedded human small Intestine. (antibody concentration 3 ug/ml)

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC-P
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Caldesmon/CALD1 Antibody Summary

Immunogen
CALD1 (NP_004333.1, 1 a.a. - 538 a.a.) full-length human protein. MDDFERRRELRRQKREEMRLEAERIAYQRNDDDEEEAARERRRRARQERLRQKQEEESLGQVTDQVEVNAQNSVPDEEAKTTTTNTQVEGDDEAAFLERLARREERRQKRLQEALERQKEFDPTITDASLSLPSRRMQNDTAENETTEKEEKSESRQERYEIEETETVTKSYQKNDWRDAEENKKEDKEKEEEEEEKPKRGSIGENQIKDEKIKKDKEPKEEVKSFMDRKKGFTEVKSQNGEFMTHKLKHTENTFSRPGGRASVDTKEAEGAPQVEAGKRLEELRRRRGETESEEFEKLKQKQQEAALELEELKKKREERRKVLEEEEQRRKQEEADRKLREEEEKRRLKEEIERRRAEAAEKRQKMPEDGLSDDKKPFKCFTPKGSSLKIEERAEFLNKSVQKSSGVKSTHQAAIVSKIDSRLEQYTSAIEGTKSAKPTKPAASDLPVPAEGVRNIKSMWEKGNVFSSPTAAGTPNKETAGLKVGVSSRINEWLTKTPDGNKSPAPKPSDLRPGDVSSKRNLWEKQSVDKVTSPTKV
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
CALD1
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunohistochemistry-Paraffin
Application Notes
This antibody is useful for WB, Functional and IHC-P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Caldesmon/CALD1 Antibody

  • CAD
  • CALD1
  • caldesmon 1
  • Caldesmon
  • CDM
  • CDMH-CAD
  • HCAD
  • LCAD
  • L-CAD
  • MGC21352
  • NAG22

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NB120-15200
Species: Hu, Mu, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-87744
Species: Hu
Applications: WB, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-86648
Species: Hu
Applications: WB, IHC, IHC-P
AF7947
Species: Hu, Mu, Rt
Applications: WB, IHC
NB600-1293
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
H00085366-M01
Species: Hu
Applications: WB, ELISA, RNAi

Publications for Caldesmon/CALD1 Antibody (H00000800-B01P) (0)

There are no publications for Caldesmon/CALD1 Antibody (H00000800-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Caldesmon/CALD1 Antibody (H00000800-B01P) (0)

There are no reviews for Caldesmon/CALD1 Antibody (H00000800-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Caldesmon/CALD1 Antibody (H00000800-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Caldesmon/CALD1 Products

Bioinformatics Tool for Caldesmon/CALD1 Antibody (H00000800-B01P)

Discover related pathways, diseases and genes to Caldesmon/CALD1 Antibody (H00000800-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Caldesmon/CALD1 Antibody (H00000800-B01P)

Discover more about diseases related to Caldesmon/CALD1 Antibody (H00000800-B01P).
 

Pathways for Caldesmon/CALD1 Antibody (H00000800-B01P)

View related products by pathway.

PTMs for Caldesmon/CALD1 Antibody (H00000800-B01P)

Learn more about PTMs related to Caldesmon/CALD1 Antibody (H00000800-B01P).
 

Research Areas for Caldesmon/CALD1 Antibody (H00000800-B01P)

Find related products by research area.

Blogs on Caldesmon/CALD1

There are no specific blogs for Caldesmon/CALD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Caldesmon/CALD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CALD1
Entrez
Uniprot