Calcitonin Antibody (4B10)

Images

 
Western Blot: Calcitonin Antibody (4B10) [H00000796-M01] - Analysis of CALCA expression in transfected 293T cell line by CALCA monoclonal antibody (M01), clone 4B10.Lane 1: CALCA transfected lysate(15.5 KDa).Lane 2: ...read more
Sandwich ELISA: Calcitonin Antibody (4B10) [H00000796-M01] - Detection limit for recombinant GST tagged CALCA is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4B10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Calcitonin Antibody (4B10) Summary

Immunogen
CALCA (NP_001732, 52 a.a. - 141 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AALVQDYVQMKASELEQEQEREGSSLDSPRSKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVSMPQNAN
Specificity
CALCA - calcitonin/calcitonin-related polypeptide, alpha
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CALCA
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Calcitonin Antibody (4B10)

  • ATP2B2plasma membrane calcium ATPase
  • ATPase, Ca++ transporting, plasma membrane 4
  • DKFZp686G08106
  • DKFZp686M088
  • EC 3.6.3
  • EC 3.6.3.8
  • Matrix-remodeling-associated protein 1
  • matrix-remodelling associated 1
  • MXRA1
  • Plasma membrane calcium ATPase isoform 4
  • Plasma membrane calcium pump isoform 4
  • plasma membrane calcium pump
  • plasma membrane calcium-transporting ATPase 4
  • PMCA4b
  • PMCA4PMCA4x
  • sarcolemmal calcium pump

Background

Calcitonin is a peptide hormone synthesized by the parafollicular cells of the thyroid. It causes reduction in serum calcium, an effect opposite to that of parathyroid hormone (PTH; MIM 168450).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-35213
Species: Hu
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
MAB4077
Species: Hu
Applications: WB, IHC
NBP1-86713
Species: Hu
Applications: IHC, IHC-P
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF6108
Species: Hu
Applications: IHC
NLS6731
Species: Hu, Rt, Po, Bv, Ca, Eq, Gt, Ha, Mk, Pm, Rb, Xp
Applications: IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NB600-713
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
H00000796-M01
Species: Hu
Applications: WB, ELISA

Publications for Calcitonin Antibody (H00000796-M01) (0)

There are no publications for Calcitonin Antibody (H00000796-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Calcitonin Antibody (H00000796-M01) (0)

There are no reviews for Calcitonin Antibody (H00000796-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Calcitonin Antibody (H00000796-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Calcitonin Products

Bioinformatics Tool for Calcitonin Antibody (H00000796-M01)

Discover related pathways, diseases and genes to Calcitonin Antibody (H00000796-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Calcitonin Antibody (H00000796-M01)

Discover more about diseases related to Calcitonin Antibody (H00000796-M01).
 

Pathways for Calcitonin Antibody (H00000796-M01)

View related products by pathway.

PTMs for Calcitonin Antibody (H00000796-M01)

Learn more about PTMs related to Calcitonin Antibody (H00000796-M01).
 

Research Areas for Calcitonin Antibody (H00000796-M01)

Find related products by research area.

Blogs on Calcitonin

There are no specific blogs for Calcitonin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Calcitonin Antibody (4B10) and receive a gift card or discount.

Bioinformatics

Gene Symbol CALCA
Entrez
OMIM
Uniprot