Calcineurin B Antibody (4E1.) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related Calcineurin B Primary Antibodies

Order Details


    • Catalog Number
      H00005534-M01PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Calcineurin B Antibody (4E1.) [PE] Summary

Immunogen
PPP3R1 (AAH27913, 1 a.a. - 170 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
Specificity
PPP3R1 - protein phosphatase 3 (formerly 2B), regulatory subunit B, 19kDa, alpha isoform (calcineurin B, type I)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PPP3R1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Calcineurin B Antibody (4E1.) [PE]

  • Calcineurin B
  • calcineurin subunit B type 1
  • CALNB1
  • CNA2
  • Cnb1
  • MCIP1
  • PP2B beta 1
  • PPP3R1
  • Protein phosphatase 2B regulatory subunit 1
  • protein phosphatase 2B regulatory subunit B alpha
  • protein phosphatase 3 (formerly 2B), regulatory subunit B (19kD), alpha isoform(calcineurin B, type I)
  • protein phosphatase 3 (formerly 2B), regulatory subunit B, 19kDa, alpha isoform(calcineurin B, type I)
  • protein phosphatase 3 (formerly 2B), regulatory subunit B, alpha isoform
  • Protein phosphatase 3 regulatory subunit B alpha isoform 1
  • protein phosphatase 3, regulatory subunit B, alpha
  • type I (19kDa)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33041
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP1-32567
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00005535-T01
Species: Hu
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86656
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84425
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-45548
Species: Hu
Applications: WB, IHC, IF
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-07799
Species: Hu
H00005534-M01PE
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF

Publications for Calcineurin B Antibody (H00005534-M01PE) (0)

There are no publications for Calcineurin B Antibody (H00005534-M01PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Calcineurin B Antibody (H00005534-M01PE) (0)

There are no reviews for Calcineurin B Antibody (H00005534-M01PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Calcineurin B Antibody (H00005534-M01PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Calcineurin B Products

Bioinformatics Tool for Calcineurin B Antibody (H00005534-M01PE)

Discover related pathways, diseases and genes to Calcineurin B Antibody (H00005534-M01PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Calcineurin B Antibody (H00005534-M01PE)

Discover more about diseases related to Calcineurin B Antibody (H00005534-M01PE).
 

Pathways for Calcineurin B Antibody (H00005534-M01PE)

View related products by pathway.

PTMs for Calcineurin B Antibody (H00005534-M01PE)

Learn more about PTMs related to Calcineurin B Antibody (H00005534-M01PE).
 

Research Areas for Calcineurin B Antibody (H00005534-M01PE)

Find related products by research area.

Blogs on Calcineurin B

There are no specific blogs for Calcineurin B, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Calcineurin B Antibody (4E1.) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP3R1
Entrez