Cadherin-8 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CDH8. Source: E. coli
Amino Acid Sequence: TLTVTLTDVNDNPPKFAQSLYHFSVPEDVVLGTAIGRVKANDQDIGENAQSSYDIIDGDGTALFEITSDAQAQDGIIRLRKPLDFETKKSYTLKVEAANVHIDPRFSGRGPFKDTAT Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
CDH8 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87571. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
30 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Cadherin-8 Recombinant Protein Antigen
Background
The cadherins are a family of Ca++-dependent adhesion molecules that function to mediate cell-cell binding critical to the maintenance of tissue structure and morphogenesis. Cadherins each contain a large extracellular domain at the amino terminus, which is characterized by a series of five homologous repeats, the most distal of which is thought to be responsible for binding specificity. The relatively short carboxy terminal, intracellular domain interacts with a variety of cytoplasmic proteins, including beta-catenin, to regulate cadherin function. cadherin-8 expression has been seen in mouse thymus tissue as well as in specific subdivisions of the developing central nervous system. It plays a potential role in brain morphology.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: BA
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Mu
Applications: Dual ISH-IHC, IHC, Simple Western, WB
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Publications for Cadherin-8 Protein (NBP1-87571PEP) (0)
There are no publications for Cadherin-8 Protein (NBP1-87571PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Cadherin-8 Protein (NBP1-87571PEP) (0)
There are no reviews for Cadherin-8 Protein (NBP1-87571PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Cadherin-8 Protein (NBP1-87571PEP) (0)
Additional Cadherin-8 Products
Research Areas for Cadherin-8 Protein (NBP1-87571PEP)
Find related products by research area.
|
Blogs on Cadherin-8