Recombinant Human Cadherin-4/R-Cadherin Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Cadherin-4/R-Cadherin Peptides and Proteins

Order Details


    • Catalog Number
      H00001002-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Cadherin-4/R-Cadherin Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-100 of Human CDH4 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:AADADVDPNIGPYVFELPFVPAAVRKNWTITRLNGDYAQLSLRILYLEAGMYDVPIIVTDSGNPPLSNTSIIKVKVCPCDDNGDCTTIGAVAAAGLGTGA

Protein/Peptide Type
Partial Recombinant Protein
Gene
CDH4

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Cadherin-4/R-Cadherin Protein

  • CAD4
  • cadherin 4, type 1, preproprotein
  • cadherin 4, type 1, R-cadherin (retinal)
  • Cadherin4
  • Cadherin-4
  • CDH4
  • FLJ22202
  • FLJ40547
  • MGC126700
  • MGC138355
  • RCAD
  • R-CAD
  • R-Cadherin
  • Retinal cadherin

Background

CDH4 - cadherin 4, type 1, R-cadherin (retinal)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-48309
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
6774-CA
Species: Hu
NBP1-48309
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
MAB1790
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-58593
Species: Hu
Applications: WB, ICC/IF
35740002
Species: Hu
Applications: WB, ELISA
H00028513-B01P
Species: Hu
Applications: WB, ELISA
AF761
Species: Mu
Applications: WB, Simple Western, Flow, IHC, AdBlk, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-89680
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF2715
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-19719
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15723
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
355-BM/CF
Species: Hu, Mu, Rt
AF7669
Species: Hu, Mu, Rt
Applications: WB
NBP1-86780
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
H00001002-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Cadherin-4/R-Cadherin Partial Recombinant Protein (H00001002-Q01) (0)

There are no publications for Cadherin-4/R-Cadherin Partial Recombinant Protein (H00001002-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cadherin-4/R-Cadherin Partial Recombinant Protein (H00001002-Q01) (0)

There are no reviews for Cadherin-4/R-Cadherin Partial Recombinant Protein (H00001002-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cadherin-4/R-Cadherin Partial Recombinant Protein (H00001002-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cadherin-4/R-Cadherin Products

Bioinformatics Tool for Cadherin-4/R-Cadherin Partial Recombinant Protein (H00001002-Q01)

Discover related pathways, diseases and genes to Cadherin-4/R-Cadherin Partial Recombinant Protein (H00001002-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cadherin-4/R-Cadherin Partial Recombinant Protein (H00001002-Q01)

Discover more about diseases related to Cadherin-4/R-Cadherin Partial Recombinant Protein (H00001002-Q01).
 

Pathways for Cadherin-4/R-Cadherin Partial Recombinant Protein (H00001002-Q01)

View related products by pathway.

PTMs for Cadherin-4/R-Cadherin Partial Recombinant Protein (H00001002-Q01)

Learn more about PTMs related to Cadherin-4/R-Cadherin Partial Recombinant Protein (H00001002-Q01).

Blogs on Cadherin-4/R-Cadherin

There are no specific blogs for Cadherin-4/R-Cadherin, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Cadherin-4/R-Cadherin Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CDH4
Entrez